SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR260W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR260W
Domain Number 1 Region: 268-461,558-677
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.71e-59
Family Diacylglycerol kinase-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
lipid modification 1.931 58.71
nicotinamide nucleotide metabolic process 1.961 34.93
glycerolipid metabolic process 1.635 26.5
coenzyme metabolic process 1.576 20.88
single-organism behavior 1.382 19.83
cognition 1.703 19.83
cell activation 1.454 19.07
platelet activation 2.105 19.07
chemical synaptic transmission 1.941 18.84
regulation of membrane potential 1.78 18.84
Molecular Function IC (bits) H-Score
nucleoside-triphosphatase regulator activity 1.577 16.04
ATP binding 1.433 10.73
GTPase binding 1.608 6.59
cofactor binding 1.546 5.36
magnesium ion binding 1.87 4.13
enzyme inhibitor activity 1.385 2.9
Cellular Component IC (bits) H-Score
perinuclear region of cytoplasm 1.758 18.89
ciliary part 1.819 14.99
cilium 1.675 9.27
endosome 1.351 4.61

Protein sequence

External link(s) Locus: YLR260W   Protein: S000004250
Sequence length 687
Comment LCB5 SGDID:S000004250, Chr XII from 665846-667909, Verified ORF, "Minor sphingoid long-chain base kinase, paralog of Lcb4p responsible for few percent of the total activity, possibly involved in synthesis of long-chain base phosphates, which function as signaling molecules"
Sequence
MTLKPSKRRKGRSRHSRKKQITSAILTEEGIMIKAKPSSPYTYANRMADKRSRSSIDNIS
RTSFQSNISRTSFQSNSDNNSIFETASLISCVTCLSDTDTIDRSETSTTDTSKDDLSANP
KLHYPSVNGQLPANTVIPYGRILDARYIEKEPLHYYDANSSPSSPLSSSMSNISEKCDLD
ELESSQKKERKGNSLSRGSNSSSSLLTSRSPFTKLVEVIFARPRRHDVVPKRVSLYIDYK
PHSSSHLKEEDDLVEEILKRSYKNTRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASR
CSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAI
TEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRIDLMCCSQPSYAREHPKLSFLSQTY
GLIAETDINTEFIRWMGPARFELGVAFNIIQKKKYPCEIYVKYAAKSKNELKNHYLEHKN
KGSLEFQHITMNKDNEDCDNYNYENEYETENEDEDEDADADDEDSHLISRDLADSSADQI
KEEDFKIKYPLDEGIPSDWERLDPNISNNLGIFYTGKMPYVAADTKFFPAALPSDGTMDM
VITDARTSLTRMAPILLGLDKGSHVLQPEVLHSKILAYKIIPKLGNGLFSVDGEKFPLEP
LQVEIMPRLCKTLLRNGRYVDTDFDSM
Download sequence
Identical sequences Q06147
4932.YLR260W YLR260W YLR260W YLR260W YLR260W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]