SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR260W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR260W
Domain Number 1 Region: 268-461,558-677
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.71e-59
Family Diacylglycerol kinase-like 0.0049
Further Details:      
 

Protein sequence

External link(s) Locus: YLR260W   Protein: S000004250
Sequence length 687
Comment LCB5 SGDID:S000004250, Chr XII from 665846-667909, Verified ORF, "Minor sphingoid long-chain base kinase, paralog of Lcb4p responsible for few percent of the total activity, possibly involved in synthesis of long-chain base phosphates, which function as signaling molecules"
Sequence
MTLKPSKRRKGRSRHSRKKQITSAILTEEGIMIKAKPSSPYTYANRMADKRSRSSIDNIS
RTSFQSNISRTSFQSNSDNNSIFETASLISCVTCLSDTDTIDRSETSTTDTSKDDLSANP
KLHYPSVNGQLPANTVIPYGRILDARYIEKEPLHYYDANSSPSSPLSSSMSNISEKCDLD
ELESSQKKERKGNSLSRGSNSSSSLLTSRSPFTKLVEVIFARPRRHDVVPKRVSLYIDYK
PHSSSHLKEEDDLVEEILKRSYKNTRRNKSIFVIINPFGGKGKAKKLFMTKAKPLLLASR
CSIEVVYTKYPGHAIEIAREMDIDKYDTIACASGDGIPHEVINGLYQRPDHVKAFNNIAI
TEIPCGSGNAMSVSCHWTNNPSYSTLCLIKSIETRIDLMCCSQPSYAREHPKLSFLSQTY
GLIAETDINTEFIRWMGPARFELGVAFNIIQKKKYPCEIYVKYAAKSKNELKNHYLEHKN
KGSLEFQHITMNKDNEDCDNYNYENEYETENEDEDEDADADDEDSHLISRDLADSSADQI
KEEDFKIKYPLDEGIPSDWERLDPNISNNLGIFYTGKMPYVAADTKFFPAALPSDGTMDM
VITDARTSLTRMAPILLGLDKGSHVLQPEVLHSKILAYKIIPKLGNGLFSVDGEKFPLEP
LQVEIMPRLCKTLLRNGRYVDTDFDSM
Download sequence
Identical sequences Q06147
YLR260W 4932.YLR260W YLR260W YLR260W YLR260W

Jump to [ Top of page · Domain architecture · Domain assignment details ]