SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR261C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR261C   Protein: S000004251
Sequence length 108
Comment VPS63 SGDID:S000004251, Chr XII from 668565-668239, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 98% of ORF overlaps the verified gene YPT6; deletion causes a vacuolar protein sorting defect"
Sequence
MKEVTKMLYCALLVTKVIYQMKGKSQPKRERKKQNYWVLKSLWKRPQRQAIMSKLYSKRL
PNRCLNFKTASQLLWIAKMQIVQTKINRESLIFLQQRSRNKALVSVST
Download sequence
Identical sequences O13549
YLR261C YLR261C YLR261C 4932.YLR261C YLR261C YLR261C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]