SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR261C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR261C   Protein: S000004251
Sequence length 108
Comment VPS63 SGDID:S000004251, Chr XII from 668565-668239, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 98% of ORF overlaps the verified gene YPT6; deletion causes a vacuolar protein sorting defect"
Sequence
MKEVTKMLYCALLVTKVIYQMKGKSQPKRERKKQNYWVLKSLWKRPQRQAIMSKLYSKRL
PNRCLNFKTASQLLWIAKMQIVQTKINRESLIFLQQRSRNKALVSVST
Download sequence
Identical sequences O13549
YLR261C 4932.YLR261C YLR261C YLR261C YLR261C YLR261C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]