SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR263W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR263W
Domain Number - Region: 733-799
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0144
Family Apolipoprotein A-I 0.006
Further Details:      
 

Protein sequence

External link(s) Locus: YLR263W   Protein: S000004253
Sequence length 827
Comment RED1 SGDID:S000004253, Chr XII from 670342-672825, Verified ORF, "Protein component of the axial elements of the synaptonemal complex, involved in chromosome segregation during the first meiotic division; interacts with Hop1p; required for wild-type levels of Mek1p kinase activity"
Sequence
MEGLKKKIFGVCLKNDLAQTRNETKGIHYGLMTLETSKQLQEFLHLLVIKREVIQNFELL
FHIINVAVKITDSNLPSDDIWHFILKLRFSSEINIDEDSKVLNYLLETGIAMENPVSWKC
LAVISSILSSVPQSKKIITNLIETEHAKKIGQLFDNIQDLQQGNFLVEILSNCFKKSASN
SKKVEKIPQLWQSRSKNKFFFENEFYPFSSKNGSLQTCQFLCNNFMSTLSFTGILRQVSY
SGSETLKNLRIFKKKDDENSYFIQCIYNKIYLWLDEKAPLEFERKKIRITKNLKNKIQIK
LRQPFHECVRTTADKTALLFNKTKGFQLEFEDEKLGETFFHNVNNIPKISEVQNFLVLDY
IEEEPENEGEEEEQIGRADEQKEDEEEESLDELSTPMVYPIKSSIPHNHNEKVQLVTPDR
SVSIRSDEWDLKSNTEDEEGNVLADLKISSTKETKRQTDYVHIDSEDQSPVVSAQMRKMR
RESTKTLEILRQEFKDKDVQNKEDQSEQIQNPFVNTSSLVVGKSCLVNPKEKPNIDQTVV
GITELKSNSSIKKRDINILDTIFGQPPSKKQKQFHKKEKKKQQKKLTNFKPIIDVPSQDK
RNLRSNAPTKPKSIKVSKLRTDKKVTGEKSSPETAAEKVDDQTVRSNDEQAMSRATKEKC
FPDVNEGKEITKDDAKVSLESKKNNETFVDSSVVEKHTPPDKDCNNCNITDILESTTVID
LQSPHGLSAPGQNTFTNKLQEQIYSSINHFSNELVRKISIINQELNKKILKELSEKYQKL
FSELQDNFQNDTNEMLKFMGEIKDMMNLPEDQLVHAIRTRKFDNNKR
Download sequence
Identical sequences P14291
YLR263W 4932.YLR263W YLR263W YLR263W YLR263W

Jump to [ Top of page · Domain architecture · Domain assignment details ]