SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YLR287C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR287C-A   Protein: S000004278
Sequence length 63
Comment RPS30A SGDID:S000004278, Chr XII from 713160-713158,712727-712539, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps30Bp and has similarity to rat S30 ribosomal protein"
Sequence
MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGP
SVQ
Download sequence
Identical sequences A6ZP27 C8ZGU2 G2WN55 P0CX33 P0CX34 W7PK87
YLR287C-A YOR182C tr|A6ZP27|A6ZP27_YEAS7 YLR287C-A YOR182C YOR182C YOR182C YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YOR182C YOR182C YOR182C YLR287C-A YOR182C 4932.YLR287C-A 4932.YOR182C 1vw9.f 1vwv.f 1vxw.e 1vxz.e 3izb.Z 3j16.E 3u5c.e 3u5g.e 4byl.4 4byt.4 YLR287C-A YOR182C YOR182C YLR287C-A YOR182C YT736 YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YOR182C YOR182C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]