SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR287C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR287C-A   Protein: S000004278
Sequence length 63
Comment RPS30A SGDID:S000004278, Chr XII from 713160-713158,712727-712539, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps30Bp and has similarity to rat S30 ribosomal protein"
Sequence
MAKVHGSLARAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLVNGKRRMNPGP
SVQ
Download sequence
Identical sequences A6ZP27 C8ZGU2 G2WN55 P0CX33 P0CX34
YLR287C-A YOR182C YOR182C YOR182C YLR287C-A YOR182C YLR287C-A YOR182C YOR182C YLR287C-A YOR182C YOR182C YOR182C YLR287C-A YOR182C YT736 YLR287C-A YOR182C YLR287C-A YOR182C YLR287C-A YOR182C 4932.YLR287C-A 4932.YOR182C YLR287C-A YOR182C YOR182C YLR287C-A YOR182C YOR182C tr|A6ZP27|A6ZP27_YEAS7 3izb.Z 3j16.E 3u5c.e 3u5g.e YLR287C-A YOR182C YOR182C YLR287C-A YOR182C YOR182C YOR182C

Jump to [ Top of page · Domain architecture · Domain assignment details ]