SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR299C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR299C-A   Protein: S000028680
Sequence length 30
Comment YLR299C-A SGDID:S000028680, Chr XII from 728005-727913, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene ECM38"
Sequence
MPFSPDIAYSINYALGKYFFHRISHFLESA
Download sequence
Identical sequences Q8TGM3
YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A 4932.YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]