SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR299C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR299C-A   Protein: S000028680
Sequence length 30
Comment YLR299C-A SGDID:S000028680, Chr XII from 728005-727913, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified gene ECM38"
Sequence
MPFSPDIAYSINYALGKYFFHRISHFLESA
Download sequence
Identical sequences Q8TGM3
YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A 4932.YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A YLR299C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]