SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR322W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR322W   Protein: S000004314
Sequence length 104
Comment VPS65 SGDID:S000004314, Chr XII from 777628-777942, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 75% of ORF overlaps the verified gene SFH1; deletion causes a vacuolar protein sorting defect"
Sequence
MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQ
SVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF
Download sequence
Identical sequences O13554
YLR322W YLR322W 4932.YLR322W YLR322W YLR322W

Jump to [ Top of page · Domain architecture · Domain assignment details ]