SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR322W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR322W   Protein: S000004314
Sequence length 104
Comment VPS65 SGDID:S000004314, Chr XII from 777628-777942, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 75% of ORF overlaps the verified gene SFH1; deletion causes a vacuolar protein sorting defect"
Sequence
MRHCIIFIVCISIVEIRTVHIEFIKEIVVIFRIVDHFSPFMLPCLLSHCKDGDTIIFVCQ
SVMKVRNISLWNKLVLVRHCVLLCAFLLSFFNVLHSIISICRIF
Download sequence
Identical sequences O13554
YLR322W YLR322W 4932.YLR322W YLR322W YLR322W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]