SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR333C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR333C
Domain Number 1 Region: 44-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.51e-05
Family FtsK C-terminal domain-like 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YLR333C   Protein: S000004325
Sequence length 108
Comment RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein"
Sequence
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYV
SVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAAASE
Download sequence
Identical sequences A7A1L5 B3RHK7 C7GUA3 C8ZDU4 E7KFW1 E7KS16 E7LXY2 E7NKY8 E7QIB9 G2WJF3 H0GYI8 J6EML2 P0C0T4
YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C 4932.YLR333C YLR333C SCRT_04280 YLR333C tr|A7A1L5|A7A1L5_YEAS7 YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C

Jump to [ Top of page · Domain architecture · Domain assignment details ]