SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR333C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR333C
Domain Number 1 Region: 44-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000151
Family FtsK C-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
endosome 1.323 31.16
nucleoplasm part 1.496 14.89
condensed chromosome 2.187 13.57
RNA polymerase complex 1.998 12.92
chromosomal part 1.477 12.26
replication fork 2.208 12.19
dendrite 1.585 9.45
ubiquitin ligase complex 1.917 8.87
microtubule cytoskeleton 1.341 8.45
spindle 1.789 8.45

Protein sequence

External link(s) Locus: YLR333C   Protein: S000004325
Sequence length 108
Comment RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein"
Sequence
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYV
SVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAAASE
Download sequence
Identical sequences A7A1L5 B3RHK7 C7GUA3 C8ZDU4 E7KFW1 E7KS16 E7LXY2 E7NKY8 E7QIB9 G2WJF3 H0GYI8 J6EML2 N1NYM5 P0C0T4 W7PG41 W7RGK0
YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C SCRT_04280 YLR333C tr|A7A1L5|A7A1L5_YEAS7 YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C 4932.YLR333C YLR333C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]