SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR333C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR333C
Domain Number 1 Region: 44-102
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000151
Family FtsK C-terminal domain-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
protein-DNA complex 1.923 57.09
cytoplasmic vesicle part 1.417 32.5
endosome 1.351 32.5
endosome membrane 1.934 32.5
chromosomal part 1.512 14.52
transferase complex 1.369 13.95
nucleoplasm part 1.369 13.95
DNA-directed RNA polymerase II, holoenzyme 2.009 10.79
replication fork 2.213 9.78
cytosol 1.295 7.87

Protein sequence

External link(s) Locus: YLR333C   Protein: S000004325
Sequence length 108
Comment RPS25B SGDID:S000004325, Chr XII from 795899-795573, reverse complement, Verified ORF, "Protein component of the small (40S) ribosomal subunit; nearly identical to Rps25Ap and has similarity to rat S25 ribosomal protein"
Sequence
MPPKQQLSKAAKAAAALAGGKKSKKKWSKKSMKDRAQHAVILDQEKYDRILKEVPTYRYV
SVSVLVDRLKIGGSLARIALRHLEKEGIIKPISKHSKQAIYTRAAASE
Download sequence
Identical sequences A0A0L8VLJ8 A7A1L5 B3RHK7 C7GUA3 C8ZDU4 E7KFW1 E7KS16 E7LXY2 E7NKY8 E7QIB9 G2WJF3 H0GYI8 J6EML2 N1NYM5 P0C0T4
YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C tr|A7A1L5|A7A1L5_YEAS7 YLR333C YLR333C YLR333C YLR333C YLR333C YLR333C SCRT_04280 YLR333C YLR333C YLR333C YLR333C YLR333C 4932.YLR333C YLR333C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]