SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR338W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR338W   Protein: S000004330
Sequence length 285
Comment OPI9 SGDID:S000004330, Chr XII from 804346-805203, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF VRP1/YLR337C"
Sequence
MFFESRPIVGVGGGGGACGGLLTCVGRDAEGKGGADTLGREILELFLWWLLCAGLTEGIC
GLFCGTFGAEAPDNGSGGAGDDGTMGIGGAAEDGISGIGGAEDEGILGTAGAGDNGALGM
GGAATDGTAPGIGGALADGEGLVLALLLICFNFGIPPAKISPNCGAPIPGIGGADIEGPL
LLTVPELPEADETTPPPTIGALLSLVSAFFSFIPFLMSPNRASRPCITDFAGLGALPPNA
GGGGGGGGAGAPAISTIRYIYGRLLQQTVVRFLVVCFVSYQKLSS
Download sequence
Identical sequences O94084
YLR338W 4932.YLR338W YLR338W YLR338W YLR338W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]