SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR338W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR338W   Protein: S000004330
Sequence length 285
Comment OPI9 SGDID:S000004330, Chr XII from 804346-805203, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF VRP1/YLR337C"
Sequence
MFFESRPIVGVGGGGGACGGLLTCVGRDAEGKGGADTLGREILELFLWWLLCAGLTEGIC
GLFCGTFGAEAPDNGSGGAGDDGTMGIGGAAEDGISGIGGAEDEGILGTAGAGDNGALGM
GGAATDGTAPGIGGALADGEGLVLALLLICFNFGIPPAKISPNCGAPIPGIGGADIEGPL
LLTVPELPEADETTPPPTIGALLSLVSAFFSFIPFLMSPNRASRPCITDFAGLGALPPNA
GGGGGGGGAGAPAISTIRYIYGRLLQQTVVRFLVVCFVSYQKLSS
Download sequence
Identical sequences O94084
YLR338W 4932.YLR338W YLR338W YLR338W YLR338W

Jump to [ Top of page · Domain architecture · Domain assignment details ]