SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR343W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR343W
Domain Number 1 Region: 56-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.23e-52
Family beta-glycanases 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
external encapsulating structure 1.632 21.56
endoplasmic reticulum part 1.429 19.07
microvillus 1.896 10.4
external side of plasma membrane 1.922 7.48
extracellular space 1.523 5.72
cell-cell junction 1.375 5.52
symplast 2.045 4.79
brush border 1.48 4.6
lytic vacuole 1.57 4.48
vacuolar part 1.621 4.41

Protein sequence

External link(s) Locus: YLR343W   Protein: S000004335
Sequence length 555
Comment GAS2 SGDID:S000004335, Chr XII from 816094-817761, Verified ORF, "1,3-beta-glucanosyltransferase, involved with Gas4p in spore wall assembly; has similarity to Gas1p"
Sequence
MNKKQNFYAAIIVAIFLCLQLSHGSSGVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQ
LQRSEEELSNANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICME
ALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTND
HTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYG
INMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSV
WSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPT
EVESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCS
KVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESL
QPLTSESICKNVFDSIRNITYNHGDYSKSNPSRSKESLNVKYPSSEERENDGTIAFKTSG
FVILLISMIAAGILL
Download sequence
Identical sequences N1P1N2 Q06135
YLR343W 2w62.A 2w63.A YLR343W 4932.YLR343W YLR343W YLR343W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]