SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR343W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR343W
Domain Number 1 Region: 56-323
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.23e-52
Family beta-glycanases 0.055
Further Details:      
 

Protein sequence

External link(s) Locus: YLR343W   Protein: S000004335
Sequence length 555
Comment GAS2 SGDID:S000004335, Chr XII from 816094-817761, Verified ORF, "1,3-beta-glucanosyltransferase, involved with Gas4p in spore wall assembly; has similarity to Gas1p"
Sequence
MNKKQNFYAAIIVAIFLCLQLSHGSSGVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQ
LQRSEEELSNANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICME
ALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNEVTND
HTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYG
INMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSV
WSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPT
EVESVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCS
KVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESL
QPLTSESICKNVFDSIRNITYNHGDYSKSNPSRSKESLNVKYPSSEERENDGTIAFKTSG
FVILLISMIAAGILL
Download sequence
Identical sequences N1P1N2 Q06135
YLR343W 2w62.A 2w63.A YLR343W 4932.YLR343W YLR343W YLR343W

Jump to [ Top of page · Domain architecture · Domain assignment details ]