SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR347W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR347W-A   Protein: S000028681
Sequence length 46
Comment YLR347W-A SGDID:S000028681, Chr XII from 824788-824928, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified ORF KAP95/YLR347C"
Sequence
MEAEVSATVSVAYSTIVVKAEKADARALNSLSILFAAPIKPSTRAG
Download sequence
Identical sequences C8ZDV5 Q8TGM2
YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A 4932.YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]