SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR347W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR347W-A   Protein: S000028681
Sequence length 46
Comment YLR347W-A SGDID:S000028681, Chr XII from 824788-824928, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the verified ORF KAP95/YLR347C"
Sequence
MEAEVSATVSVAYSTIVVKAEKADARALNSLSILFAAPIKPSTRAG
Download sequence
Identical sequences C8ZDV5 Q8TGM2
YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A 4932.YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A YLR347W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]