SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR354C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR354C
Domain Number 1 Region: 13-333
Classification Level Classification E-value
Superfamily Aldolase 9.84e-117
Family Class I aldolase 0.00000000877
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
cilium 1.637 14.39
ciliary part 1.792 14.39
sperm part 2.181 14.39
chromosomal part 1.471 4.84
nuclear chromosome 1.727 4.84
nuclear chromatin 2.17 4.84
plastid 1.557 4.24

Protein sequence

External link(s) Locus: YLR354C   Protein: S000004346
Sequence length 335
Comment TAL1 SGDID:S000004346, Chr XII from 837356-836349, reverse complement, Verified ORF, "Transaldolase, enzyme in the non-oxidative pentose phosphate pathway; converts sedoheptulose 7-phosphate and glyceraldehyde 3-phosphate to erythrose 4-phosphate and fructose 6-phosphate"
Sequence
MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTY
AKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQAT
IEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVAC
AEAQVTLISPFVGRILDWYKSSTGKDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFR
STDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFD
LNEDAMATEKLSEGIRKFSADIVTLFDLIEKKVTA
Download sequence
Identical sequences B3RHM3 B5VNP4 C7GRX9 C8ZDW1 E7KFX0 E7LXZ3 G2WJH2 H0GKP3 N1NZP0 P15019 W7PN87 W7RGK7
YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354c___KOG2772 YLR354C YLR354C YLR354C YLR354C YLR354C 4932.YLR354C YLR354C YLR354C YLR354C SCRT_04298 YLR354C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]