SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR354C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR354C
Domain Number 1 Region: 13-333
Classification Level Classification E-value
Superfamily Aldolase 9.84e-117
Family Class I aldolase 8.77e-09
Further Details:      
 

Protein sequence

External link(s) Locus: YLR354C   Protein: S000004346
Sequence length 335
Comment TAL1 SGDID:S000004346, Chr XII from 837356-836349, reverse complement, Verified ORF, "Transaldolase, enzyme in the non-oxidative pentose phosphate pathway; converts sedoheptulose 7-phosphate and glyceraldehyde 3-phosphate to erythrose 4-phosphate and fructose 6-phosphate"
Sequence
MSEPAQKKQKVANNSLEQLKASGTVVVADTGDFGSIAKFQPQDSTTNPSLILAAAKQPTY
AKLIDVAVEYGKKHGKTTEEQVENAVDRLLVEFGKEILKIVPGRVSTEVDARLSFDTQAT
IEKARHIIKLFEQEGVSKERVLIKIASTWEGIQAAKELEEKDGIHCNLTLLFSFVQAVAC
AEAQVTLISPFVGRILDWYKSSTGKDYKGEADPGVISVKKIYNYYKKYGYKTIVMGASFR
STDEIKNLAGVDYLTISPALLDKLMNSTEPFPRVLDPVSAKKEAGDKISYISDESKFRFD
LNEDAMATEKLSEGIRKFSADIVTLFDLIEKKVTA
Download sequence
Identical sequences B3RHM3 B5VNP4 C7GRX9 C8ZDW1 E7KFX0 E7LXZ3 G2WJH2 H0GKP3 P15019
YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C YLR354C 4932.YLR354C YLR354C SCRT_04298 YLR354C YLR354c___KOG2772 YLR354C YLR354C YLR354C YLR354C

Jump to [ Top of page · Domain architecture · Domain assignment details ]