SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR383W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR383W
Domain Number 1 Region: 81-350
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-28
Family ABC transporter ATPase domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 82-130,886-1081
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.77e-21
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 644-749,816-868,1004-1081
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000127
Family ABC transporter ATPase domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.39 26.96
microtubule associated complex 2.062 25.24
cilium 1.637 21.89
ciliary part 1.792 20.48
chromosomal part 1.471 20.12
transporter complex 1.657 19
midbody 2.148 18.28
side of membrane 1.57 16.03
endosome 1.318 12.91
nucleoplasm part 1.424 12.35

Protein sequence

External link(s) Locus: YLR383W   Protein: S000004375
Sequence length 1114
Comment SMC6 SGDID:S000004375, Chr XII from 885288-888632, Verified ORF, "Protein involved in structural maintenance of chromosomes; essential subunit of Mms21-Smc5-Smc6 complex; required for growth, DNA repair, interchromosomal and sister chromatid recombination; homologous to S. pombe rad18"
Sequence
MISTTISGKRPIEQVDDELLSLTAQQENEEQQQQRKRRRHQFAPMTQFNSNTLDEDSGFR
SSSDVATADQDNFLEESPSGYIKKVILRNFMCHEHFELELGSRLNFIVGNNGSGKSAILT
AITIGLGAKASETNRGSSLKDLIREGCYSAKIILHLDNSKYGAYQQGIFGNEIIVERIIK
RDGPASFSLRSENGKEISNKKKDIQTVVDYFSVPVSNPMCFLSQDAARSFLTASTSQDKY
SHFMKGTLLQEITENLLYASAIHDSAQENMALHLENLKSLKAEYEDAKKLLRELNQTSDL
NERKMLLQAKSLWIDVAHNTDACKNLENEISGIQQKVDEVTEKIRNRQEKIERYTSDGTT
IEAQIDAKVIYVNEKDSEHQNARELLRDVKSRFEKEKSNQAEAQSNIDQGRKKVDALNKT
IAHLEEELTKEMGGDKDQMRQELEQLEKANEKLREVNNSLVVSLQDVKNEERDIQHERES
ELRTISRSIQNKKVELQNIAKGNDTFLMNFDRNMDRLLRTIEQRKNEFETPAIGPLGSLV
TIRKGFEKWTRSIQRAISSSLNAFVVSNPKDNRLFRDIMRSCGIRSNIPIVTYCLSQFDY
SKGRAHGNYPTIVDALEFSKPEIECLFVDLSRIERIVLIEDKNEARNFLQRNPVNVNMAL
SLRDRRSGFQLSGGYRLDTVTYQDKIRLKVNSSSDNGTQYLKDLIEQETKELQNIRDRYE
EKLSEVRSRLKEIDGRLKSTKNEMRKTNFRMTELKMNVGKVVDTGILNSKINERKNQEQA
IASYEAAKEELGLKIEQIAQEAQPIKEQYDSTKLALVEAQDELQQLKEDINSRQSKIQKY
KDDTIYYEDKKKVYLENIKKIEVNVAALKEGIQRQIQNACAFCSKERIENVDLPDTQEEI
KRELDKVSRMIQKAEKSLGLSQEEVIALFEKCRNKYKEGQKKYMEIDEALNRLHNSLKAR
DQNYKNAEKGTCFDADMDFRASLKVRKFSGNLSFIKDTKSLEIYILTTNDEKARNVDTLS
GGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIARTQTIII
TPQDIGKIADIDSSGVSIHRMRDPERQNNSNFYN
Download sequence
Identical sequences N1P1S0 Q12749
YLR383W 4932.YLR383W YLR383W YLR383W YLR383W YLR383W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]