SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR392C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR392C
Domain Number - Region: 14-115
Classification Level Classification E-value
Superfamily E set domains 0.091
Family Arrestin/Vps26-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR392C   Protein: S000004384
Sequence length 518
Comment YLR392C SGDID:S000004384, Chr XII from 906305-904749, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YLR392C is not an essential gene"
Sequence
MAPKISISLNPPYNGEFYSSNDQMSGIVSLQLTKALSIRKISVILKGFSETLTKIDQEYM
FQQNGMMMPGQDNKSFHTLMKFEQRVFPPDNVWNALDGSSKPFKVKPGSYNYSFQFDKFP
RKPECLKNHTAKTVAFVTRSNARLPPTFNSHWQEFNKIDNLDLYFYSFGKVIYMVQVQLE
LGKSSSWFKPFHKLIREIETFEFIPEPKDLIIEPDEDDNEELNAFSNNSRGNSMVTNNEF
FNSSNLKVPSKDVKVVNGVGYIKSDRNFSQANSILIENGDIRSRPVSSVTSTRQSTRLVN
GMKVFPSTYKMGLPDGESNMRIEVRSRDLKQIYRKDYLFRSGSQNFDKVYVVMEGNIASL
SKMQITPLKLQLNLLETTTYLSQGIANGNYSSLKLIEIDLNQLKSNKPLLDLNEIRENFD
GSMFECELRLKDHPILRKLVFNEEDYRHRGNRLYSFKTCTIKRTFSLQLLIEWGINGIRK
QSEVNIDPVQIFCQVREHVEAEALPRYVPPPTYTEMAS
Download sequence
Identical sequences P18634
YLR392C YLR392C YLR392C 4932.YLR392C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]