SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR392C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YLR392C
Domain Number - Region: 14-115
Classification Level Classification E-value
Superfamily E set domains 0.091
Family Arrestin/Vps26-like 0.068
Further Details:      
 

Protein sequence

External link(s) Locus: YLR392C   Protein: S000004384
Sequence length 518
Comment YLR392C SGDID:S000004384, Chr XII from 906305-904749, reverse complement, Uncharacterized ORF, "Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm; YLR392C is not an essential gene"
Sequence
MAPKISISLNPPYNGEFYSSNDQMSGIVSLQLTKALSIRKISVILKGFSETLTKIDQEYM
FQQNGMMMPGQDNKSFHTLMKFEQRVFPPDNVWNALDGSSKPFKVKPGSYNYSFQFDKFP
RKPECLKNHTAKTVAFVTRSNARLPPTFNSHWQEFNKIDNLDLYFYSFGKVIYMVQVQLE
LGKSSSWFKPFHKLIREIETFEFIPEPKDLIIEPDEDDNEELNAFSNNSRGNSMVTNNEF
FNSSNLKVPSKDVKVVNGVGYIKSDRNFSQANSILIENGDIRSRPVSSVTSTRQSTRLVN
GMKVFPSTYKMGLPDGESNMRIEVRSRDLKQIYRKDYLFRSGSQNFDKVYVVMEGNIASL
SKMQITPLKLQLNLLETTTYLSQGIANGNYSSLKLIEIDLNQLKSNKPLLDLNEIRENFD
GSMFECELRLKDHPILRKLVFNEEDYRHRGNRLYSFKTCTIKRTFSLQLLIEWGINGIRK
QSEVNIDPVQIFCQVREHVEAEALPRYVPPPTYTEMAS
Download sequence
Identical sequences P18634
YLR392C 4932.YLR392C YLR392C YLR392C

Jump to [ Top of page · Domain architecture · Domain assignment details ]