SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR395C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR395C
Domain Number 1 Region: 29-74
Classification Level Classification E-value
Superfamily Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) 0.00000327
Family Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
respiratory chain complex 2.02 20.02
mitochondrial respiratory chain 2.098 16.76
inner mitochondrial membrane protein complex 1.909 16.76
mitochondrial envelope 1.593 15.47
organelle inner membrane 1.692 12.99

Protein sequence

External link(s) Locus: YLR395C   Protein: S000004387
Sequence length 78
Comment COX8 SGDID:S000004387, Chr XII from 909965-909729, reverse complement, Verified ORF, "Subunit VIII of cytochrome c oxidase, which is the terminal member of the mitochondrial inner membrane electron transport chain"
Sequence
MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYALSHFGFFAIG
FAVPFVACYVQLKKSGAF
Download sequence
Identical sequences A7A1S0 B3RHR0 C7GXJ9 G2WJL0 N1P060 P04039 W7PQ29
YLR395C YLR395C 4932.YLR395C YLR395C YLR395C tr|A7A1S0|A7A1S0_YEAS7 YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C YLR395C SCRT_04336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]