SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR398C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR398C
Domain Number 1 Region: 341-481,596-648,688-781
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-47
Family Tandem AAA-ATPase domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) Locus: YLR398C   Protein: S000004390
Sequence length 1287
Comment SKI2 SGDID:S000004390, Chr XII from 919019-915156, reverse complement, Verified ORF, "Putative RNA helicase, involved in exosome mediated 3' to 5' mRNA degradation and translation inhibition of non-poly(A) mRNAs; forms complex with Ski3p and Ski8p; required for repressing propagation of dsRNA viruses"
Sequence
MSEGFSSSSIQELYQSLKEITNNADVELFEDRITKLDFESTDEPKHANDIIKDRFLRPSN
ALPWSLLDMVQDVPHTSSPEDCSGKLDYKELLKVPDPINRTSYQFKRTGLEGKISGYKEE
VDLKEVANANASNSLSITRSINHNQNSVRGSTAQLPFTPGGIPMKSVKTDSEQNGSSTMA
NATKLLHKDGQGLFDIPEGMNRGIKPMDSPAENEDQNGQFKELKQLNEIDNELDIRIEAN
EAKLKEEEKSAKSISEEIMEEATEETTADNADDAEIDELLPIGIDFGRTKPVSKSVPVKK
EWAHVVDLNHKIENFDELIPNPARSWPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVV
AEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLITGDVQINPDANCLIMT
TEILRSMLYRGADLIRDVEFVIFDEVHYVNDQDRGVVWEEVIIMLPQHVKFILLSATVPN
TYEFANWIGRTKQKNIYVISTPKRPVPLEINIWAKKELIPVINQNSEFLEANFRKHKEIL
NGESAKGAPSKTDNGRGGSTARGGRGGSNTRDGRGGRGNSTRGGANRGGSRGAGAIGSNK
RKFFTQDGPSKKTWPEIVNYLRKRELLPMVVFVFSKKRCEEYADWLEGINFCNNKEKSQI
HMFIEKSITRLKKEDRDLPQILKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLF
ATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVMAY
NSPLSIATFKEVTMGVPTRLQSQFRLTYNMILNLLRIEALRVEEMIKYSFSENAKETLQP
EHEKQIKVLQEELQTIEYKSCEICDNDIEKFLELMLAYKEATVNLMQEMVKSPSILHILK
EGRLVAFRDPNDCLKLGFVFKVSLKDAVCVIMTFTKPYKLPNGEPNHLIYFPKADGYRRR
NFPKFQKTDFYMEEVPVTAIEVITKRKFAAPLGKVIKKDVAALNEFNAETNNILDGKTLK
EAINIEKQGLKIHQILLDRTNIRDEIFKLKSIKCPNLSQHIVPKFKAHVIKKKIEELYHL
MSDQNLSLLPDYEKRLAVLKDTEFIDQNHNVLLKGRVACEINSGYELVLTELILDNFLGS
FEPEEIVALLSVFVYEGKTREEEPPIVTPRLAKGKQRIEEIYKKMLCVFNTHQIPLTQDE
AEFLDRKRFAMMNVVYEWARGLSFKEIMEMSPEAEGTVVRVITWLDEICREVKTASIIIG
NSTLHMKMSRAQELIKRDIVFAASLYL
Download sequence
Identical sequences N1NYS9 P35207
YR80 4932.YLR398C YLR398C YLR398C YLR398C YLR398C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]