SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR399C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR399C
Domain Number 1 Region: 294-427
Classification Level Classification E-value
Superfamily Bromodomain 8.63e-37
Family Bromodomain 0.00017
Further Details:      
 
Domain Number 2 Region: 135-258
Classification Level Classification E-value
Superfamily Bromodomain 7.85e-31
Family Bromodomain 0.00033
Further Details:      
 

Protein sequence

External link(s) Locus: YLR399C   Protein: S000004391
Sequence length 686
Comment BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p"
Sequence
MTDITPVQNDVDVNGNNVNDDVSSNLKRPIDQGDPSNGLAEEENPANNQLHLKKARLDGD
ALTSSPAGLAENGIEGATLAANGENGYNATGSGAEDEQQGLKKEEGGQGTKQEDLDENSK
QELPMEVPKEPAPAPPPEPDMNNLPQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPV
KLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMA
RNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSKD
IYPYESKKPKSKRLQQAMKFCQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKE
PMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKWAD
RPNLDDYDSDEDSRTQGDYDDYESEYSESDIDETIITNPAIQYLEEQLARMKVELQQLKK
QELEKIRKERRLARGSKKRGKRSKGRSGSKNASSKGRRDKKNKLKTVVTYDMKRIITERI
NDLPTSKLERAIDIIKKSMPNISEDDEVELDLDTLDNHTILTLYNTFFRQYESSSGASNG
LDGTSGVTRDASSLSPTSAGSRKRRSKALSQEEQSRQIEKIKNKLAILDSASPLSQNGSP
GQIQSAAHNGFSSSSDDDVSSESEEE
Download sequence
Identical sequences N1P7C3 P35817
YLR399C YLR399C 4932.YLR399C YLR399C YLR399C

Jump to [ Top of page · Domain architecture · Domain assignment details ]