SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YLR399C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR399C
Domain Number 1 Region: 294-427
Classification Level Classification E-value
Superfamily Bromodomain 8.63e-37
Family Bromodomain 0.00017
Further Details:      
 
Domain Number 2 Region: 135-258
Classification Level Classification E-value
Superfamily Bromodomain 7.85e-31
Family Bromodomain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ATPase complex 2.002 46.82
transferase complex 1.369 35.45
nuclear transcription factor complex 2.016 9.34
methyltransferase complex 2.143 9.21
chromosomal part 1.512 9.2
dendrite 1.582 6.46
nuclear chromosome part 1.842 5.57
nucleoplasm part 1.369 4.15
chromatin 1.876 3.61

Protein sequence

External link(s) Locus: YLR399C   Protein: S000004391
Sequence length 686
Comment BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p"
Sequence
MTDITPVQNDVDVNGNNVNDDVSSNLKRPIDQGDPSNGLAEEENPANNQLHLKKARLDGD
ALTSSPAGLAENGIEGATLAANGENGYNATGSGAEDEQQGLKKEEGGQGTKQEDLDENSK
QELPMEVPKEPAPAPPPEPDMNNLPQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPV
KLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMA
RNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSKD
IYPYESKKPKSKRLQQAMKFCQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKE
PMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKWAD
RPNLDDYDSDEDSRTQGDYDDYESEYSESDIDETIITNPAIQYLEEQLARMKVELQQLKK
QELEKIRKERRLARGSKKRGKRSKGRSGSKNASSKGRRDKKNKLKTVVTYDMKRIITERI
NDLPTSKLERAIDIIKKSMPNISEDDEVELDLDTLDNHTILTLYNTFFRQYESSSGASNG
LDGTSGVTRDASSLSPTSAGSRKRRSKALSQEEQSRQIEKIKNKLAILDSASPLSQNGSP
GQIQSAAHNGFSSSSDDDVSSESEEE
Download sequence
Identical sequences N1P7C3 P35817
YLR399C NP_013503.1 YLR399C YLR399C 4932.YLR399C YLR399C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]