SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR399C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR399C
Domain Number 1 Region: 294-427
Classification Level Classification E-value
Superfamily Bromodomain 8.63e-37
Family Bromodomain 0.00017
Further Details:      
 
Domain Number 2 Region: 135-258
Classification Level Classification E-value
Superfamily Bromodomain 7.85e-31
Family Bromodomain 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
SWI/SNF superfamily-type complex 2.177 54.65
nucleoplasm part 1.419 36.71
chromosomal part 1.478 28.96
chromatin 1.906 13.55
methyltransferase complex 2.218 11.2
microtubule cytoskeleton 1.333 7.57
nuclear chromosome 1.723 6.04
condensed chromosome 2.187 5.49
transcription factor complex 1.881 5.47
DNA-directed RNA polymerase complex 2.004 5.13

Protein sequence

External link(s) Locus: YLR399C   Protein: S000004391
Sequence length 686
Comment BDF1 SGDID:S000004391, Chr XII from 921596-919536, reverse complement, Verified ORF, "Protein involved in transcription initiation at TATA-containing promoters; associates with the basal transcription factor TFIID; contains two bromodomains; corresponds to the C-terminal region of mammalian TAF1; redundant with Bdf2p"
Sequence
MTDITPVQNDVDVNGNNVNDDVSSNLKRPIDQGDPSNGLAEEENPANNQLHLKKARLDGD
ALTSSPAGLAENGIEGATLAANGENGYNATGSGAEDEQQGLKKEEGGQGTKQEDLDENSK
QELPMEVPKEPAPAPPPEPDMNNLPQNPIPKHQQKHALLAIKAVKRLKDARPFLQPVDPV
KLDIPFYFNYIKRPMDLSTIERKLNVGAYEVPEQITEDFNLMVNNSIKFNGPNAGISQMA
RNIQASFEKHMLNMPAKDAPPVIAKGRRSSAQEDAPIVIRRAQTHNGRPKRTIHPPKSKD
IYPYESKKPKSKRLQQAMKFCQSVLKELMAKKHASYNYPFLEPVDPVSMNLPTYFDYVKE
PMDLGTIAKKLNDWQYQTMEDFERDVRLVFKNCYTFNPDGTIVNMMGHRLEEVFNSKWAD
RPNLDDYDSDEDSRTQGDYDDYESEYSESDIDETIITNPAIQYLEEQLARMKVELQQLKK
QELEKIRKERRLARGSKKRGKRSKGRSGSKNASSKGRRDKKNKLKTVVTYDMKRIITERI
NDLPTSKLERAIDIIKKSMPNISEDDEVELDLDTLDNHTILTLYNTFFRQYESSSGASNG
LDGTSGVTRDASSLSPTSAGSRKRRSKALSQEEQSRQIEKIKNKLAILDSASPLSQNGSP
GQIQSAAHNGFSSSSDDDVSSESEEE
Download sequence
Identical sequences N1P7C3 P35817
YLR399C YLR399C 4932.YLR399C YLR399C YLR399C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]