SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR399W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR399W-A   Protein: S000028682
Sequence length 34
Comment YLR399W-A SGDID:S000028682, Chr XII from 920869-920973, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the characterized ORF BDF1/YLR399C"
Sequence
MFLAICDMPAFGPLNLILLLTMRLKSSVICSGTS
Download sequence
Identical sequences C8ZE09 Q8TGM1
YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A 4932.YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]