SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR399W-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR399W-A   Protein: S000028682
Sequence length 34
Comment YLR399W-A SGDID:S000028682, Chr XII from 920869-920973, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the characterized ORF BDF1/YLR399C"
Sequence
MFLAICDMPAFGPLNLILLLTMRLKSSVICSGTS
Download sequence
Identical sequences C8ZE09 Q8TGM1
YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A YLR399W-A 4932.YLR399W-A YLR399W-A YLR399W-A YLR399W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]