SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR403W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR403W
Domain Number 1 Region: 596-622,654-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-06
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  YLR403W
Domain Number - Region: 524-555
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family GUN4-associated domain 0.079
Further Details:      
 

Protein sequence

External link(s) Locus: YLR403W   Protein: S000004395
Sequence length 683
Comment SFP1 SGDID:S000004395, Chr XII from 925567-927618, Verified ORF, "Transcription factor that controls expression of many ribosome biogenesis genes in response to nutrients and stress, regulates G2/M transitions during mitotic cell cycle and DNA-damage response, involved in cell size modulation"
Sequence
MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNT
DFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSI
SVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGY
SISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMN
SAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANL
QSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVI
SITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGI
NINNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLV
QDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDD
DDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKC
PVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYR
CEVCGKRYKNLNGLKYHRGHSTH
Download sequence
Identical sequences N1NZU0 P32432
YLR403W YLR403W 4932.YLR403W YLR403W YLR403W

Jump to [ Top of page · Domain architecture · Domain assignment details ]