SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR403W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR403W
Domain Number 1 Region: 596-622,654-678
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000056
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  YLR403W
Domain Number - Region: 524-555
Classification Level Classification E-value
Superfamily ARM repeat 0.046
Family GUN4-associated domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleolus 1.641 7.25
nucleoplasm part 1.496 6.67
nuclear body 1.907 6.67
chromatin 1.822 5.88
ribonucleoprotein complex 1.414 5.53
small nuclear ribonucleoprotein complex 2.005 5.53
chromosomal region 1.98 5.46
SWI/SNF superfamily-type complex 2.178 5.41
chromosomal part 1.477 5.27

Protein sequence

External link(s) Locus: YLR403W   Protein: S000004395
Sequence length 683
Comment SFP1 SGDID:S000004395, Chr XII from 925567-927618, Verified ORF, "Transcription factor that controls expression of many ribosome biogenesis genes in response to nutrients and stress, regulates G2/M transitions during mitotic cell cycle and DNA-damage response, involved in cell size modulation"
Sequence
MDFTTMTMASNMATSTTTTATSAHASINSSSNFNIDIDSNQNTPSILINNNSDSSNGKNT
DFNGVNNIHQKNIMNNTNNVHLYSPNIMDQTLLTPQDIAKLRRESIAHSQGMGGVSWGSI
SVGSWLRDEIISRRNSIVPASANGAASAAASATTTATNTLQIQQPTKRPSVSNPPYHRGY
SISPQIAYTAYLPNLEKQYCKDYSCCGLSLPGLHDLLRHYEEAHISTSPNTTNMSQIPMN
SAGNTSSSVRMTNNTSSANYNLQNNMAANTKNAGHKTNTMQAHSSNATNNTSINNMHANL
QSNMDSNSTIRQSQHPHHQQNIIQQQLQSNSVNHTSGAVPTPSVMGSATASSTTANPNVI
SITGAPNSGLSMANHSQQLHLNGNLVDAVSTNDVFLRTSNSPSRHVPHNKQINSNNNSGI
NINNNTSHNSNINMGSKNAMVNRPHTFNNYSLNKTSRNPIQHQSRKIDPHQTDLSPLVLV
QDIDLSFMDDDILGPSNHNSMNSVVNPTTGSHNYNTFHSSVHAKSSQNMVEDQDIDDIDD
DDDVDDDDDDDDDDDTENGSSSNGKSVHNNNYKMPQQAYIDDPARRLYVMDHEEQKPFKC
PVIGCEKTYKNQNGLKYHRLHGHQNQKLHENPDGTFSVIDPDSTDSFGDGMGSAKDKPYR
CEVCGKRYKNLNGLKYHRGHSTH
Download sequence
Identical sequences N1NZU0 P32432
YLR403W YLR403W YLR403W 4932.YLR403W YLR403W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]