SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR429W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR429W
Domain Number 1 Region: 51-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-39
Family WD40-repeat 0.00072
Further Details:      
 

Protein sequence

External link(s) Locus: YLR429W   Protein: S000004421
Sequence length 651
Comment CRN1 SGDID:S000004421, Chr XII from 990774-992729, Verified ORF, "Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity; plays a role in regulation of actin patch assembly"
Sequence
MSGKFVRASKYRHVFGQAAKKELQYEKLKVTNNAWDSNLLKTNGKFIAVNWNASGGGAFA
VIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDH
VDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK
HPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRL
ATTGFSKLSDRQIGIWDAFNIEKGDLGGFYTVDQSSGILMPFYDEGNKILYLVGKGDGNI
RYYEFQNDELFELSEFQSTEAQRGFAVAPKRMVNVKENEVLKGFKTVVDQRIEPVSFFVP
RRSEEFQEDIYPDAPSNKPALTAEEWFSGKSVEGPILVSMRSIYDGSAPSFHEAKRPQQP
TTQETALEEKKEQPKVEKPISESEKEVKQEAPKSPSPLKSASSSSTINHVLKEDNSINKL
LKKSSDIDQVNNAEDPSRDTSGWEEADDEPAPIKIETPVTPTETKKDRTPKVEPSKELKP
EPVSIATDRKQEQSLPQEEKSSEKTKSPEQEKSATPPSSITAAKTAITASSKEEPSAART
SPKSLGLKKSVEKLSTLVLQLEDVVDKLTKANLDKDERLLKLEQKIGELSK
Download sequence
Identical sequences N1NYV0 Q06440
YLR429W YLR429W 4932.YLR429W YLR429W YLR429W YLR429W

Jump to [ Top of page · Domain architecture · Domain assignment details ]