SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YLR429W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR429W
Domain Number 1 Region: 51-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.49e-39
Family WD40-repeat 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YLR429W   Protein: S000004421
Sequence length 651
Comment CRN1 SGDID:S000004421, Chr XII from 990774-992729, Verified ORF, "Coronin, cortical actin cytoskeletal component that associates with the Arp2p/Arp3p complex to regulate its activity; plays a role in regulation of actin patch assembly"
Sequence
MSGKFVRASKYRHVFGQAAKKELQYEKLKVTNNAWDSNLLKTNGKFIAVNWNASGGGAFA
VIPIEEVGKAPDQVPLFRGHTAQVLDTDFDPFNDHRIASGSDDSKIGIWDIPENYKFHDH
VDEDGEPIDIKPVKFLTGHARKVGHVLYHPVAENVLASSSGDYTVKLWNVETGKDMITLK
HPDMVTSMSFSYDGNYLATVARDKKLRVWNIREEKIVSEGPAHTGAKNQRVVWLGNSDRL
ATTGFSKLSDRQIGIWDAFNIEKGDLGGFYTVDQSSGILMPFYDEGNKILYLVGKGDGNI
RYYEFQNDELFELSEFQSTEAQRGFAVAPKRMVNVKENEVLKGFKTVVDQRIEPVSFFVP
RRSEEFQEDIYPDAPSNKPALTAEEWFSGKSVEGPILVSMRSIYDGSAPSFHEAKRPQQP
TTQETALEEKKEQPKVEKPISESEKEVKQEAPKSPSPLKSASSSSTINHVLKEDNSINKL
LKKSSDIDQVNNAEDPSRDTSGWEEADDEPAPIKIETPVTPTETKKDRTPKVEPSKELKP
EPVSIATDRKQEQSLPQEEKSSEKTKSPEQEKSATPPSSITAAKTAITASSKEEPSAART
SPKSLGLKKSVEKLSTLVLQLEDVVDKLTKANLDKDERLLKLEQKIGELSK
Download sequence
Identical sequences N1NYV0 Q06440
YLR429W 4932.YLR429W YLR429W YLR429W YLR429W YLR429W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]