SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR442C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR442C
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily BAH domain 6.15e-86
Family BAH domain 7.21e-07
Further Details:      
 
Weak hits

Sequence:  YLR442C
Domain Number - Region: 659-745,777-839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0066
Family Extended AAA-ATPase domain 0.045
Further Details:      
 

Protein sequence

External link(s) Locus: YLR442C   Protein: S000004434
Sequence length 978
Comment SIR3 SGDID:S000004434, Chr XII from 1022248-1019312, reverse complement, Verified ORF, "Silencing protein that interacts with Sir2p and Sir4p, and histone H3 and H4 tails, to establish a transcriptionally silent chromatin state; required for spreading of silenced chromatin; recruited to chromatin through interaction with Rap1p"
Sequence
MAKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFND
NVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYK
DKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPT
AEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVSGQKTNRQVMHKMGVERSSKRLAKK
PSMKKIKIEPSADDDVNNGNIPSQRGTSTTHGSISPQEESVSPNISSASPSALTSPTDSS
KILQKRSISKELIVSEEIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENF
VYANNPEVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQETQEFS
KNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFATLSKLKKKYQIILD
RFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKACSSSGRETILSNFNADINLEESIR
ESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSS
ARKELPIFDYIHIDALELAGMDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRK
TLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEI
KLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQKIPDNVIVINHKI
NNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFS
EAINGFKDETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGY
KASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPL
EINYAFSMDEEFKNMDCI
Download sequence
Identical sequences N1NZY0 P06701
YLR442C YLR442C 4932.YLR442C YLR442C YLR442C

Jump to [ Top of page · Domain architecture · Domain assignment details ]