SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR442C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR442C
Domain Number 1 Region: 1-214
Classification Level Classification E-value
Superfamily BAH domain 6.15e-86
Family BAH domain 7.21e-07
Further Details:      
 
Weak hits

Sequence:  YLR442C
Domain Number - Region: 659-745,777-839
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0066
Family Extended AAA-ATPase domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
SWI/SNF superfamily-type complex 2.177 13.96
nucleoplasm part 1.419 3.31
Biological Process IC (bits) H-Score
negative regulation of gene expression, epigenetic 2.217 17.38
gene silencing 1.896 12.6
regulation of gene expression, epigenetic 1.749 10.64

Protein sequence

External link(s) Locus: YLR442C   Protein: S000004434
Sequence length 978
Comment SIR3 SGDID:S000004434, Chr XII from 1022248-1019312, reverse complement, Verified ORF, "Silencing protein that interacts with Sir2p and Sir4p, and histone H3 and H4 tails, to establish a transcriptionally silent chromatin state; required for spreading of silenced chromatin; recruited to chromatin through interaction with Rap1p"
Sequence
MAKTLKDLDGWQVIITDDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFND
NVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPLEFYK
DKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIEDRDFLVRYACEPT
AEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVSGQKTNRQVMHKMGVERSSKRLAKK
PSMKKIKIEPSADDDVNNGNIPSQRGTSTTHGSISPQEESVSPNISSASPSALTSPTDSS
KILQKRSISKELIVSEEIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENF
VYANNPEVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQETQEFS
KNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFATLSKLKKKYQIILD
RFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKACSSSGRETILSNFNADINLEESIR
ESLQKRELLKSQVEDFTRIFLPIYDSLMSSQNKLFYITNADDSTKFQLVNDVMDELITSS
ARKELPIFDYIHIDALELAGMDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRK
TLILIQNPENLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIREQINIMPSLKAHFTEI
KLNKVDKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQKIPDNVIVINHKI
NNKITQLIAKNVANVSGSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFS
EAINGFKDETISKKIIGMSLLMRTFLYTLAQETEGTNRHTLALETVLIKMVKMLRDNPGY
KASKEIKKVICGAWEPAITIEKLKQFSWISVVNDLVGEKLVVVVLEEPSASIMVELKLPL
EINYAFSMDEEFKNMDCI
Download sequence
Identical sequences N1NZY0 P06701
YLR442C YLR442C 4932.YLR442C YLR442C YLR442C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]