SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR458W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR458W   Protein: S000004450
Sequence length 126
Comment YLR458W SGDID:S000004450, Chr XII from 1056453-1056833, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data; overlaps 5' end of essential NBP1 gene required for mitosis"
Sequence
MSPQTFCILLIFSLSLEKTSLIVWNIFVNLRLGVFLLLVRIFSSVFLSVTFLGLFRTLLP
VGRICFLLLLKADRFLTSSRDPYSRFLPSSRIPKKSFHSPCTDFSILPMSIIVPFSSEYL
LVHVQQ
Download sequence
Identical sequences YLR458W YLR458W 4932.YLR458W YLR458W YLR458W

Jump to [ Top of page · Domain architecture · Domain assignment details ]