SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR458W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR458W   Protein: S000004450
Sequence length 126
Comment YLR458W SGDID:S000004450, Chr XII from 1056453-1056833, Dubious ORF, "Dubious open reading frame unlikely to encode a functional protein, based on available experimental and comparative sequence data; overlaps 5' end of essential NBP1 gene required for mitosis"
Sequence
MSPQTFCILLIFSLSLEKTSLIVWNIFVNLRLGVFLLLVRIFSSVFLSVTFLGLFRTLLP
VGRICFLLLLKADRFLTSSRDPYSRFLPSSRIPKKSFHSPCTDFSILPMSIIVPFSSEYL
LVHVQQ
Download sequence
Identical sequences YLR458W YLR458W 4932.YLR458W YLR458W YLR458W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]