SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR463C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR463C   Protein: S000004455
Sequence length 183
Comment YLR463C SGDID:S000004455, Chr XII from 1066814-1066263, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the uncharacterized ORFs YLR462W and YLR464W"
Sequence
MGSSFVIDRSSSSPAPPRGPAPKLSAHARKIICKISPNRSFLFIISLHICEKYFISMGLR
GHRSRFSRSVSTFFSPGKLACIAHLRVGCQIVPIFPYGAFLKTPYNRCAGNKVSESTHRR
AVVRPSTRYFVTTFQDTETQLIIVSSVEVKKRKGIVILSIEFQSMHLKQRVDHQVDFLGN
KIL
Download sequence
Identical sequences O13557
YLR463C 4932.YLR463C YLR463C YLR463C

Jump to [ Top of page · Domain architecture · Domain assignment details ]