SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR463C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR463C   Protein: S000004455
Sequence length 183
Comment YLR463C SGDID:S000004455, Chr XII from 1066814-1066263, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; overlaps the uncharacterized ORFs YLR462W and YLR464W"
Sequence
MGSSFVIDRSSSSPAPPRGPAPKLSAHARKIICKISPNRSFLFIISLHICEKYFISMGLR
GHRSRFSRSVSTFFSPGKLACIAHLRVGCQIVPIFPYGAFLKTPYNRCAGNKVSESTHRR
AVVRPSTRYFVTTFQDTETQLIIVSSVEVKKRKGIVILSIEFQSMHLKQRVDHQVDFLGN
KIL
Download sequence
Identical sequences O13557
YLR463C YLR463C YLR463C 4932.YLR463C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]