SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR465C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR465C   Protein: S000004457
Sequence length 102
Comment BSC3 SGDID:S000004457, Chr XII from 1067351-1067043, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 100% of YLR465C overlaps the uncharacterized ORF YLR464W and 86% of YLR465C overlaps the verified gene YRF1-4"
Sequence
MDHPHKWHRKLVNCNSDFIFKSRGHFVSISSQLGQHNFTIFNRYHLKKRIVFQILVNSSL
RFSEQNFSITQNEAGIWKQLFNSPQSFPHTDIPSEEGTKVIL
Download sequence
Identical sequences O13558
YLR465C 4932.YLR465C YLR465C YLR465C YLR465C

Jump to [ Top of page · Domain architecture · Domain assignment details ]