SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR465C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR465C   Protein: S000004457
Sequence length 102
Comment BSC3 SGDID:S000004457, Chr XII from 1067351-1067043, reverse complement, Dubious ORF, "Dubious open reading frame, unlikely to encode a protein; not conserved in closely related Saccharomyces species; 100% of YLR465C overlaps the uncharacterized ORF YLR464W and 86% of YLR465C overlaps the verified gene YRF1-4"
Sequence
MDHPHKWHRKLVNCNSDFIFKSRGHFVSISSQLGQHNFTIFNRYHLKKRIVFQILVNSSL
RFSEQNFSITQNEAGIWKQLFNSPQSFPHTDIPSEEGTKVIL
Download sequence
Identical sequences O13558
YLR465C YLR465C YLR465C YLR465C 4932.YLR465C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]