SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR466C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR466C-A   Protein: S000028685
Sequence length 160
Comment YLR466C-A SGDID:S000028685, Chr XII from 1070867-1070385, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF YRF1-4/YLR466W"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFLVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKIFQISYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences P0CL38 P0CL39 P0CL40
YGR296C-B YHR219C-A YLL066W-A YLR466C-A YLR467C-A YML133W-B YNL339W-B YOR396C-A YPL283W-B YPR204C-A YGR296C-B YHL050W-A YIL177W-A YJL225W-A 4932.YLR466C-A 4932.YLR467C-A 4932.YOR396C-A YLR466C-A YLR467C-A YOR396C-A YEL077W-A YER190C-B YFL068W YGR296C-B YHR219C-A YLL066W-A YLL067W-A YLR466C-A YLR467C-A YML133W-B YNL339W-B YOR396C-A YPL283W-B YPR204C-A YLR466C-A YLR467C-A YOR396C-A YLR466C-A YLR467C-A YOR396C-A YEL077W-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]