SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR466C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR466C-A   Protein: S000028685
Sequence length 160
Comment YLR466C-A SGDID:S000028685, Chr XII from 1070867-1070385, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF YRF1-4/YLR466W"
Sequence
MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALFLVPVQKVLQH
LCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTNCFSSSSNGQVPSIISLYLRV
DLSPFYAKIFQISYRVPMIWLDVFQVFFVFLVISQHSLHS
Download sequence
Identical sequences P0CL38 P0CL39 P0CL40
YLR466C-A YLR467C-A YOR396C-A 4932.YLR466C-A 4932.YLR467C-A 4932.YOR396C-A YLR466C-A YLR467C-A YOR396C-A YEL077W-A YEL077W-A YER190C-B YFL068W YGR296C-B YHR219C-A YLL066W-A YLL067W-A YLR466C-A YLR467C-A YML133W-B YNL339W-B YOR396C-A YPL283W-B YPR204C-A YGR296C-B YHR219C-A YLL066W-A YLR466C-A YLR467C-A YML133W-B YNL339W-B YOR396C-A YPL283W-B YPR204C-A YLR466C-A YLR467C-A YOR396C-A YGR296C-B YHL050W-A YIL177W-A YJL225W-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]