SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR466C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YLR466C-B   Protein: S000028686
Sequence length 38
Comment YLR466C-B SGDID:S000028686, Chr XII from 1071708-1071592, reverse complement, Uncharacterized ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIPTHSLTSTSTLAVIPYPAF
Download sequence
Identical sequences Q8TGJ4
YLR466C-B 4932.YLR466C-B YLR466C-B YLR466C-B YLR466C-B

Jump to [ Top of page · Domain architecture · Domain assignment details ]