SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YLR466C-B from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YLR466C-B   Protein: S000028686
Sequence length 38
Comment YLR466C-B SGDID:S000028686, Chr XII from 1071708-1071592, reverse complement, Uncharacterized ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MSLRPCLTPSSMQYSDIYIPTHSLTSTSTLAVIPYPAF
Download sequence
Identical sequences Q8TGJ4
4932.YLR466C-B YLR466C-B YLR466C-B YLR466C-B YLR466C-B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]