SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML001W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML001W
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-54
Family G proteins 5.45e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YML001W   Protein: S000004460
Sequence length 208
Comment YPT7 SGDID:S000004460, Chr XIII from 267174-267800, Verified ORF, "GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion, similar to mammalian Rab7"
Sequence
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM
QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP
FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN
QADTEAFEDDYNDAINIRLDGENNSCSC
Download sequence
Identical sequences A6ZM61 B3LLQ0 C7GLB9 C8ZEK6 E7LY88 E7QJ26 G2WK51 H0GLW6 P32939 W7PXU7 W7R6W6
YML001W YML001W ORFP:17339 YML001W YML001W YML001W YML001W YML001W YML001W YML001W YML001W 4932.YML001W YML001W SCRT_01894 YML001W YML001W tr|A6ZM61|A6ZM61_YEAS7 YML001W YML001W YML001W YML001w___KOG0394 YML001W YML001W

Jump to [ Top of page · Domain architecture · Domain assignment details ]