SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML001W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML001W
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-54
Family G proteins 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule cytoskeleton 1.341 26.13
microtubule associated complex 1.998 25.22
chromosomal part 1.477 20.37
cilium 1.573 16.39
nucleoplasm part 1.496 15.57
endosome 1.323 14.1
extrinsic component of plasma membrane 1.992 13.97
extracellular organelle 1.606 12.21
SWI/SNF superfamily-type complex 2.178 9.4
lateral plasma membrane 1.933 9.04

Protein sequence

External link(s) Locus: YML001W   Protein: S000004460
Sequence length 208
Comment YPT7 SGDID:S000004460, Chr XIII from 267174-267800, Verified ORF, "GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion, similar to mammalian Rab7"
Sequence
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM
QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP
FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN
QADTEAFEDDYNDAINIRLDGENNSCSC
Download sequence
Identical sequences A6ZM61 B3LLQ0 C7GLB9 C8ZEK6 E7LY88 E7QJ26 G2WK51 H0GLW6 P32939 W7PXU7 W7R6W6
YML001w___KOG0394 YML001W YML001W YML001W YML001W 4932.YML001W SCRT_01894 YML001W YML001W YML001W YML001W ORFP:17339 YML001W YML001W YML001W tr|A6ZM61|A6ZM61_YEAS7 YML001W YML001W YML001W YML001W YML001W YML001W YML001W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]