SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML001W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML001W
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-54
Family G proteins 0.0000000545
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
actin cytoskeleton 1.374 29.03
cilium 1.675 22.42
transporter complex 1.698 22.26
ATPase complex 2.002 22.1
ciliary part 1.819 21.32
chromosomal part 1.512 20.08
midbody 2.182 17.6
side of membrane 1.633 16
nucleoplasm part 1.369 15.74
protein-DNA complex 1.923 15.74

Protein sequence

External link(s) Locus: YML001W   Protein: S000004460
Sequence length 208
Comment YPT7 SGDID:S000004460, Chr XIII from 267174-267800, Verified ORF, "GTPase; GTP-binding protein of the rab family; required for homotypic fusion event in vacuole inheritance, for endosome-endosome fusion, similar to mammalian Rab7"
Sequence
MSSRKKNILKVIILGDSGVGKTSLMHRYVNDKYSQQYKATIGADFLTKEVTVDGDKVATM
QVWDTAGQERFQSLGVAFYRGADCCVLVYDVTNASSFENIKSWRDEFLVHANVNSPETFP
FVILGNKIDAEESKKIVSEKSAQELAKSLGDIPLFLTSAKNAINVDTAFEEIARSALQQN
QADTEAFEDDYNDAINIRLDGENNSCSC
Download sequence
Identical sequences A0A0L8VKV5 A6ZM61 B3LLQ0 C7GLB9 C8ZEK6 E7LY88 E7QJ26 G2WK51 H0GLW6 P32939
YML001W YML001W YML001W YML001W YML001w___KOG0394 ORFP:17339 SCRT_01894 YML001W YML001W YML001W tr|A6ZM61|A6ZM61_YEAS7 YML001W YML001W YML001W YML001W YML001W YML001W YML001W YML001W 4932.YML001W YML001W YML001W YML001W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]