SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML004C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML004C
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.22e-33
Family Glyoxalase I (lactoylglutathione lyase) 0.0000554
Further Details:      
 
Domain Number 2 Region: 182-321
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.48e-26
Family Glyoxalase I (lactoylglutathione lyase) 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
isomerase activity 1.67 63.47
lyase activity 1.474 8.76
Cellular Component IC (bits) H-Score
transferase complex 1.423 19.41
cytosol 1.301 19.41

Protein sequence

External link(s) Locus: YML004C   Protein: S000004463
Sequence length 326
Comment GLO1 SGDID:S000004463, Chr XIII from 262685-261705, reverse complement, Verified ORF, "Monomeric glyoxalase I, catalyzes the detoxification of methylglyoxal (a by-product of glycolysis) via condensation with glutathione to produce S-D-lactoylglutathione; expression regulated by methylglyoxal levels and osmotic stress"
Sequence
MSTDSTRYPIQIEKASNDPTLLLNHTCLRVKDPARTVKFYTEHFGMKLLSRKDFEEAKFS
LYFLSFPKDDIPKNKNGEPDVFSAHGVLELTHNWGTEKNPDYKINNGNEEPHRGFGHICF
SVSDINKTCEELESQGVKFKKRLSEGRQKDIAFALGPDGYWIELITYSREGQEYPKGSVG
NKFNHTMIRIKNPTRSLEFYQNVLGMKLLRTSEHESAKFTLYFLGYGVPKTDSVFSCESV
LELTHNWGTENDPNFHYHNGNSEPQGYGHICISCDDAGALCKEIEVKYGDKIQWSPKFNQ
GRMKNIAFLKDPDGYSIEVVPHGLIA
Download sequence
Identical sequences N1P5A9 P50107
YML004C YML004C YML004C 4932.YML004C YML004C YML004C YML004C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]