SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML004C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML004C
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.22e-33
Family Glyoxalase I (lactoylglutathione lyase) 5.54e-05
Further Details:      
 
Domain Number 2 Region: 182-321
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.48e-26
Family Glyoxalase I (lactoylglutathione lyase) 6.28e-05
Further Details:      
 

Protein sequence

External link(s) Locus: YML004C   Protein: S000004463
Sequence length 326
Comment GLO1 SGDID:S000004463, Chr XIII from 262685-261705, reverse complement, Verified ORF, "Monomeric glyoxalase I, catalyzes the detoxification of methylglyoxal (a by-product of glycolysis) via condensation with glutathione to produce S-D-lactoylglutathione; expression regulated by methylglyoxal levels and osmotic stress"
Sequence
MSTDSTRYPIQIEKASNDPTLLLNHTCLRVKDPARTVKFYTEHFGMKLLSRKDFEEAKFS
LYFLSFPKDDIPKNKNGEPDVFSAHGVLELTHNWGTEKNPDYKINNGNEEPHRGFGHICF
SVSDINKTCEELESQGVKFKKRLSEGRQKDIAFALGPDGYWIELITYSREGQEYPKGSVG
NKFNHTMIRIKNPTRSLEFYQNVLGMKLLRTSEHESAKFTLYFLGYGVPKTDSVFSCESV
LELTHNWGTENDPNFHYHNGNSEPQGYGHICISCDDAGALCKEIEVKYGDKIQWSPKFNQ
GRMKNIAFLKDPDGYSIEVVPHGLIA
Download sequence
Identical sequences N1P5A9 P50107
YML004C YML004C YML004C 4932.YML004C YML004C YML004C YML004C

Jump to [ Top of page · Domain architecture · Domain assignment details ]