SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML006C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YML006C   Protein: S000004465
Sequence length 774
Comment GIS4 SGDID:S000004465, Chr XIII from 258416-256092, reverse complement, Verified ORF, "CAAX box containing protein of unknown function, proposed to be involved in the RAS/cAMP signaling pathway"
Sequence
MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA
RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN
LNNFQDPTFLEFASTSWQVQKNSKALNNNNRNSIPPPTISSSKASNGKLESNVSDDQWSN
INTQTSTATRTNTNTRTLTSPDTVDINVTSVNSQSNNNDTPQDNENEVDEEDATSSIVLN
FSHSRTVDSKPNRLPKIFPSYTNEDYTPSHSEIMSIDSFAGEDVSSTYPGQDLSLTTARR
EDESGQDEVEDHYSRVSHDLGDESIDQASYSMESSVSYTSYSSSSNSSSAHYSLSSSSRG
NPKRENIDHTNATYVSELSSITSSIDNLTTSTTPEEEDNLIHHNYDAQGYGSGEDDGEEV
YDDEDLSSSDYSVLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMA
SVTDDWLLYDSNFSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQVEEEFKNPNY
DNREGISKEQPLDSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLSEQSGPQM
YIPTRMESNVTTAHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTVLSSEP
HPMTQLSNSNTTSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAMSAVERSKS
LPLPTLLKSLSGIDNPTHATNKDRKRWKFQMNRFKNHKNSGSAGTDKSQRCAIM
Download sequence
Identical sequences A6ZM57 N1P042 Q04233
YML006C YML006C YML006C YML006C YML006C YML006C YML006C tr|A6ZM57|A6ZM57_YEAS7 YML006C YML006C 4932.YML006C NP_013708.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]