SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML008C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML008C
Domain Number 1 Region: 72-298,329-370
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.53e-56
Family CAC2371-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
methyltransferase complex 2.218 10.09
nucleoplasm part 1.418 8.55
transcription factor complex 1.882 8.55
nucleolus 1.652 7.12
trans-Golgi network 1.798 7.07
chromosomal part 1.477 5.82
chromatin 1.902 5.82
nuclear periphery 2.218 4.73
organelle inner membrane 1.673 4.69
mitochondrial envelope 1.571 4.69
Biological Process IC (bits) H-Score
protein methylation 2.104 71.85
RNA modification 2.178 56.92
mRNA metabolic process 1.627 33.21
ncRNA metabolic process 1.572 27.62
RNA processing 1.458 24.68
regulation of gene silencing 2.226 21.95
DNA modification 1.896 20.54
purine ribonucleoside metabolic process 1.419 19.61
sulfur compound metabolic process 1.55 19.61
cellular macromolecular complex assembly 1.469 19.51

Protein sequence

External link(s) Locus: YML008C   Protein: S000004467
Sequence length 383
Comment ERG6 SGDID:S000004467, Chr XIII from 252990-251839, reverse complement, Verified ORF, "Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24; localized to both lipid particles and mitochondrial outer membrane"
Sequence
MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAEE
RRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRG
DLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK
MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK
IAYEIELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL
ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVAGGKSKLFTPM
MLFVARKPENAETPSQTSQEATQ
Download sequence
Identical sequences A6ZM54 C7GLC6 G2WK44 N1P5A5 P25087
YML008C YML008C YML008C YML008C YML008C 355019 NYSGXRC-6385a YR305 YML008C YML008C 4932.YML008C YML008C YML008C YML008C tr|A6ZM54|A6ZM54_YEAS7 YML008C YML008C YML008C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]