SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML008C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML008C
Domain Number 1 Region: 72-298,329-370
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.53e-56
Family CAC2371-like 0.038
Further Details:      
 

Protein sequence

External link(s) Locus: YML008C   Protein: S000004467
Sequence length 383
Comment ERG6 SGDID:S000004467, Chr XIII from 252990-251839, reverse complement, Verified ORF, "Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24; localized to both lipid particles and mitochondrial outer membrane"
Sequence
MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAEE
RRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRG
DLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK
MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK
IAYEIELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL
ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVAGGKSKLFTPM
MLFVARKPENAETPSQTSQEATQ
Download sequence
Identical sequences A6ZM54 C7GLC6 G2WK44 P25087
YML008C YML008C YML008C YML008C YML008C 355019 NYSGXRC-6385a YR305 YML008C YML008C 4932.YML008C YML008C YML008C YML008C tr|A6ZM54|A6ZM54_YEAS7 YML008C YML008C YML008C

Jump to [ Top of page · Domain architecture · Domain assignment details ]