SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML008C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML008C
Domain Number 1 Region: 72-298,329-370
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.53e-56
Family CAC2371-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
protein methylation 2.119 82.26
RNA modification 2.218 68.35
mRNA metabolic process 1.678 35.07
mRNA processing 1.845 35.07
ncRNA processing 1.837 34.75
RNA processing 1.499 31.57
ncRNA metabolic process 1.491 31.13
DNA modification 1.951 28.48
peptidyl-amino acid modification 1.432 26.67
histone modification 1.77 20.56
Cellular Component IC (bits) H-Score
host cell part 1.996 16.09
transferase complex 1.369 14.11
nucleoplasm part 1.369 12.76
methyltransferase complex 2.143 12.28
nuclear transcription factor complex 2.016 8.84
nucleolus 1.732 8.59
organelle envelope 1.405 7.29
chromosomal part 1.512 7.04
chromatin 1.876 7.04
trans-Golgi network 1.766 6.25

Protein sequence

External link(s) Locus: YML008C   Protein: S000004467
Sequence length 383
Comment ERG6 SGDID:S000004467, Chr XIII from 252990-251839, reverse complement, Verified ORF, "Delta(24)-sterol C-methyltransferase, converts zymosterol to fecosterol in the ergosterol biosynthetic pathway by methylating position C-24; localized to both lipid particles and mitochondrial outer membrane"
Sequence
MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAEE
RRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRG
DLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK
MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK
IAYEIELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL
ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVAGGKSKLFTPM
MLFVARKPENAETPSQTSQEATQ
Download sequence
Identical sequences A6ZM54 C7GLC6 G2WK44 N1P5A5 P25087
tr|A6ZM54|A6ZM54_YEAS7 355019 NYSGXRC-6385a YR305 YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C YML008C 4932.YML008C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]