SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YML031C-A   Protein: S000028809
Sequence length 111
Comment YML031C-A SGDID:S000028809, Chr XIII from 214421-214086, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF NDC1/YML031W; questionable ORF from MIPS"
Sequence
MIKRETRLRAKILGINANASSHNGECGNASSEITTVWIIEHMKNNLVTKWLNRVLHTSLK
MVWYVYRGFNNSLGVCIICLPCNVLSSSQSHLLIAKESALPVSDSRCYYIL
Download sequence
Identical sequences A0A023PXH2
YML031C-A 4932.YML031C-A YML031C-A YML031C-A YML031C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]