SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML031C-A from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YML031C-A   Protein: S000028809
Sequence length 111
Comment YML031C-A SGDID:S000028809, Chr XIII from 214421-214086, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the verified ORF NDC1/YML031W; questionable ORF from MIPS"
Sequence
MIKRETRLRAKILGINANASSHNGECGNASSEITTVWIIEHMKNNLVTKWLNRVLHTSLK
MVWYVYRGFNNSLGVCIICLPCNVLSSSQSHLLIAKESALPVSDSRCYYIL
Download sequence
Identical sequences YML031C-A YML031C-A 4932.YML031C-A YML031C-A YML031C-A

Jump to [ Top of page · Domain architecture · Domain assignment details ]