SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML052W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YML052W
Domain Number - Region: 120-211
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00118
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Protein sequence

External link(s) Locus: YML052W   Protein: S000004516
Sequence length 302
Comment SUR7 SGDID:S000004516, Chr XIII from 170402-171310, Verified ORF, "Putative integral membrane protein; component of eisosomes; associated with endocytosis, along with Pil1p and Lsp1p; sporulation and plasma membrane sphingolipid content are altered in mutants"
Sequence
MVKVWNIVLRLVVLLFLAGNTLLLILMIISGATDHYPVNRFYWVQGNTTGIPNAGDETRW
TFWGACLQDKDGSDTCTSNLAPAYPISPVDNFNTHINVPHQFISKRDAFYYLTRFSFCFF
WIALAFVGVSFILYVLTWCSKMLSEMVLILMSFGFVFNTAAVVLQTAASAMAKNAFHDDH
RSAQLGASMMGMAWASVFLCIVEFILLVFWSVRARLASTYSIDNSRYRTSSRWNPFHREK
EQATDPILTATGPEDMQQSASIVGPSSNANPVTATAATENQPKGINFFTIRKSHERPDDV
SV
Download sequence
Identical sequences A6ZM15 B3LLK5 C7GS68 G2WK05 H0GLT1 P54003
YML052W YML052W YML052W YML052W YML052W YML052W YML052W YML052W 2301S YML052W YML052W YML052W YML052W 4932.YML052W YML052W SCRT_01848 YML052W tr|A6ZM15|A6ZM15_YEAS7 YML052W YML052W YML052W YML052W YML052W YML052W

Jump to [ Top of page · Domain architecture · Domain assignment details ]