SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML060W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML060W
Domain Number 1 Region: 121-325
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.14e-41
Family DNA repair glycosylase, 2 C-terminal domains 6.11e-05
Further Details:      
 
Domain Number 2 Region: 2-120
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.14e-21
Family DNA repair glycosylase, N-terminal domain 0.0019
Further Details:      
 

Protein sequence

External link(s) Locus: YML060W   Protein: S000004525
Sequence length 376
Comment OGG1 SGDID:S000004525, Chr XIII from 151871-153001, Verified ORF, "Mitochondrial glycosylase/lyase that specifically excises 7,8-dihydro-8-oxoguanine residues located opposite cytosine or thymine residues in DNA, repairs oxidative damage to mitochondrial DNA"
Sequence
MSYKFGKLAINKSELCLANVLQAGQSFRWIWDEKLNQYSTTMKIGQQEKYSVVILRQDEE
NEILEFVAVGDCGNQDALKTHLMKYFRLDVSLKHLFDNVWIPSDKAFAKLSPQGIRILAQ
EPWETLISFICSSNNNISRITRMCNSLCSNFGNLITTIDGVAYHSFPTSEELTSRATEAK
LRELGFGYRAKYIIETARKLVNDKAEANITSDTTYLQSICKDAQYEDVREHLMSYNGVGP
KVADCVCLMGLHMDGIVPVDVHVSRIAKRDYQISANKNHLKELRTKYNALPISRKKINLE
LDHIRLMLFKKWGSYAGWAQGVLFSKEIGGTSGSTTTGTIKKRKWDMIKETEAIVTKQMK
LKVELSDLHIKEAKID
Download sequence
Identical sequences B3LLJ5 C7GVZ6 C8ZEE5 E7KG84 E7KSU6 E7LYN2 P53397 W7PXP2 W7QUD4
YML060W YML060W YML060W YML060W YML060W YML060W NYSGXRC-P083 YML060W YML060W 4932.YML060W YML060W YML060W SCRT_01838 YML060W YML060W YML060W

Jump to [ Top of page · Domain architecture · Domain assignment details ]