SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML063W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YML063W   Protein: S000004528
Sequence length 255
Comment RPS1B SGDID:S000004528, Chr XIII from 146482-147249, Verified ORF, "Ribosomal protein 10 (rp10) of the small (40S) subunit; nearly identical to Rps1Ap and has similarity to rat S3a ribosomal protein"
Sequence
MAVGKNKRLSRGKKGLKKKVVDPFTRKEWFDIKAPSTFENRNVGKTLVNKSTGLKNASDA
LKGRVVEVCLADLQGSEDHSFRKVKLRVDEVQGKNLLTNFHGMDFTTDKLRSMVRKWQTL
IEANVTVKTSDDYVLRIFAIAFTRKQANQVKRHSYAQSSHIRAIRKVISEILTREVQNST
LAQLTSKLIPEVINKEIENATKDIFPLQNIHVRKVKLLKQPKFDVGALMALHGEGSGEEK
GKKVSGFKDEVLETV
Download sequence
Identical sequences A6ZM02 B3LLJ2 B5VP69 C8ZEE2 E7KG82 E7KSU4 E7LYM9 E7Q7I0 E7QIY1 G2WJZ2 H0GLS3 N1P675 P23248 W7PN00 W7QWX4
YML063W YML063W YML063W YML063W YML063W SCRT_01835 YML063W YML063W YML063W YML063W YML063W YML063W ORFP:17566 YML063W YR97 YML063W YML063W YML063W 4932.YML063W ORFP:16168 YML063W YML063W sp|A6ZM02|RS3A2_YEAS7 YML063W YML063W YML063W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]