SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML090W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YML090W   Protein: S000004555
Sequence length 128
Comment YML090W SGDID:S000004555, Chr XIII from 90744-91130, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data; partially overlaps the dubious ORF YML089C; exhibits growth defect on a non-fermentable (respiratory) carbon source"
Sequence
MLVFSFLFVVVSINLNALIFLCKKSWASYLFLYLYNFFFCEDEYKLTKNCVRVEAIAPFM
MCLGSLGAILGKQRTANFLLLSYNVINNPVVLVYYVENFSRINFIKHTTKEKSVIWTNER
QLNPWICN
Download sequence
Identical sequences Q04501
YML090W YML090W 4932.YML090W YML090W YML090W YML090W

Jump to [ Top of page · Domain architecture · Domain assignment details ]