SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML105C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML105C
Domain Number 1 Region: 90-198
Classification Level Classification E-value
Superfamily SRP19 1.7e-32
Family SRP19 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
RNA binding 1.361 8.75
Cellular Component IC (bits) H-Score
ribonucleoprotein complex 1.415 7.51

Protein sequence

External link(s) Locus: YML105C   Protein: S000004573
Sequence length 273
Comment SEC65 SGDID:S000004573, Chr XIII from 58687-57866, reverse complement, Verified ORF, "Subunit of the signal recognition particle (SRP), involved in protein targeting to the ER; interacts with Srp54p; homolog of mammalian SRP19"
Sequence
MPRLEEIDDFNDIDDLDMELAELDPSLRTPIAPKITPKVVRSQDQENPAFLPGTNNNSNS
NNNSSNEKEQLSFINPKTGKVERSEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPK
ELAVENPLAKTMADAVRELGILCIFEGEKCHPQDFGNPGRIRVLFKENGQLIGAATKFKG
GKRQLMKAVGEYMKRHPTTIESLREIPYGPDFDNIEFKKIPRVKGFKMNEIVPLHSPFLM
GHPMTKSVYETPKITAAEKSFKPPKNKYKVVRR
Download sequence
Identical sequences A6ZLV9 B3LLF4 B5VP26 C7GV87 C8ZE97 E7KG62 E7KSB3 E7LYK0 E7Q7F5 E7QIT0 N1NXE7 P29478 W7PEB3 W7QU78
YML105C YML105C YML105C YML105C YML105C YML105C YML105C YML105C YML105C YML105C YML105C YML105C 4932.YML105C YML105C SCRT_01794 YML105C tr|A6ZLV9|A6ZLV9_YEAS7 YML105C YML105C YML105C YML105C YML105C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]