SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML114C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YML114C   Protein: S000004582
Sequence length 510
Comment TAF8 SGDID:S000004582, Chr XIII from 43575-42043, reverse complement, Verified ORF, "TFIID subunit (65 kDa), involved in RNA polymerase II transcription initiation"
Sequence
MTSKTSESGTGTQSTIVQLRNLPDLTEISHLEIDAPVVEILKKTVLFQLNSLNICISNFA
LDELVNLVTVQMDGMFRNLHNLTLLQRRSQASQADLKLLLREFNLDAPSLYQQFQASEFI
KSKHSTEYEKLMSWSSLAALPHNEEDEEDELNNIEEQQNEINVLLPPSNPLEKQIPSWLP
NFPPDHTYKFTPEFNHPITDLKTIKKEIVKESQESEKALLNLNKSLSHISSASNTPQPPG
LDDEDAIEQQLEIWGNALEERKPTITEKSFNENNIEQYAKYRVELARERVTKFEVNQLKR
TKNPFLKISETLYLPESPHQSHKTIQKTIELQFRKSMTLFMHNLPKVQKLKKEKIRMAKE
ERAKSLKRRQEELISQRTKREQDEGHDLELLLNNEHARDAADDTTTPNALNNSTIVINTN
AEDEDDDINLFGILGSSEDENEMSSMPAENLVAESEPPTMTAQDTTNTTPVAHNTTNIDA
TTSHSPHSTPNENAPTSPPADIATDHDITM
Download sequence
Identical sequences C7GV96 G2WJU2 Q03750
YML114C 4932.YML114C YML114C YML114C YML114C YML114C YML114C Pf-sce:YML114C YML114C YML114C

Jump to [ Top of page · Domain architecture · Domain assignment details ]