SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML120C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML120C
Domain Number 1 Region: 54-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0088
Further Details:      
 
Domain Number 2 Region: 225-409
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.7e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.008
Further Details:      
 

Protein sequence

External link(s) Locus: YML120C   Protein: S000004589
Sequence length 513
Comment NDI1 SGDID:S000004589, Chr XIII from 29807-28266, reverse complement, Verified ORF, "NADH:ubiquinone oxidoreductase, transfers electrons from NADH to ubiquinone in the respiratory chain but does not pump protons, in contrast to the higher eukaryotic multisubunit respiratory complex I; phosphorylated; homolog of human AMID"
Sequence
MLSKNLYSNKRLLTSTNTLVRFASTRSTGVENSGAGPTSFKTMKVIDPQHSDKPNVLILG
SGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKG
NVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEP
NTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTG
VEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKV
HLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSS
KRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNL
SSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRI
LYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Download sequence
Identical sequences C7GVA2 N1NY48 P32340
YML120C 4932.YML120C YML120C YML120C YML120C YML120C YML120C YR269 YML120C YML120C YML120C

Jump to [ Top of page · Domain architecture · Domain assignment details ]