SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YML120C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML120C
Domain Number 1 Region: 54-281
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0088
Further Details:      
 
Domain Number 2 Region: 225-409
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.7e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)


Protein sequence

External link(s) Locus: YML120C   Protein: S000004589
Sequence length 513
Comment NDI1 SGDID:S000004589, Chr XIII from 29807-28266, reverse complement, Verified ORF, "NADH:ubiquinone oxidoreductase, transfers electrons from NADH to ubiquinone in the respiratory chain but does not pump protons, in contrast to the higher eukaryotic multisubunit respiratory complex I; phosphorylated; homolog of human AMID"
Sequence
MLSKNLYSNKRLLTSTNTLVRFASTRSTGVENSGAGPTSFKTMKVIDPQHSDKPNVLILG
SGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKG
NVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEP
NTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTG
VEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKV
HLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSS
KRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNL
SSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRI
LYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Download sequence
Identical sequences C7GVA2 N1NY48 P32340
YML120C YML120C YML120C YR269 YML120C YML120C YML120C YML120C YML120C 4932.YML120C YML120C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]