SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML122C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YML122C   Protein: S000004591
Sequence length 126
Comment YML122C SGDID:S000004591, Chr XIII from 26419-26039, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MPRNDSNQYYARWCCYRRPIRAAFARKGPFNSSSGYEENVARLKNTRSSHCRTARCQFNS
STWTCYFQHVGRKLATAIDYGSPQSIEISEIGAVMHQMSCERLSLSLFSRFACLLARLKT
CVLLIN
Download sequence
Identical sequences Q03207
YML122C YML122C YML122C YML122C YML122C YML122C YTYst236 YML122C YML122C YML122C 4932.YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C

Jump to [ Top of page · Domain architecture · Domain assignment details ]