SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YML122C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YML122C   Protein: S000004591
Sequence length 126
Comment YML122C SGDID:S000004591, Chr XIII from 26419-26039, reverse complement, Dubious ORF, "Dubious open reading frame unlikely to encode a protein, based on available experimental and comparative sequence data"
Sequence
MPRNDSNQYYARWCCYRRPIRAAFARKGPFNSSSGYEENVARLKNTRSSHCRTARCQFNS
STWTCYFQHVGRKLATAIDYGSPQSIEISEIGAVMHQMSCERLSLSLFSRFACLLARLKT
CVLLIN
Download sequence
Identical sequences Q03207
YML122C 4932.YML122C YML122C YTYst236 YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C YML122C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]