SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML124C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML124C
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 5.1e-94
Family Tubulin, GTPase domain 5.99e-09
Further Details:      
 
Domain Number 2 Region: 247-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.55e-81
Family Tubulin, C-terminal domain 3.69e-08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
guanyl nucleotide binding 2.075 12.31
GTPase activity 2.203 11.89
purine ribonucleoside triphosphate binding 1.454 7.29
purine ribonucleoside binding 1.421 7.03
Cellular Component IC (bits) H-Score
microtubule 1.95 90.42
outer membrane 2.239 8.8
spindle pole 2.218 7.95
plastid 1.6 7.48
chloroplast part 1.896 7.48
plastid stroma 2.024 7.36
microtubule cytoskeleton 1.333 6.35
cell body 1.492 5.74
cell-cell junction 1.375 5.36
symplast 2.045 4.56

Protein sequence

External link(s) Locus: YML124C   Protein: S000004593
Sequence length 445
Comment TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p"
Sequence
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
Download sequence
Identical sequences A6ZLU1 B3LLD6 C8ZE78 N1NZC7 P09734 W7PLM4 W7QWP3
YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C 4932.YML124C YML124C SCRT_01776 YML124C tr|A6ZLU1|A6ZLU1_YEAS7 YML124C YML124C YML124C YML124C YML124C YML124C YML124C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]