SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML124C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML124C
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 5.1e-94
Family Tubulin, GTPase domain 5.99e-09
Further Details:      
 
Domain Number 2 Region: 247-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.55e-81
Family Tubulin, C-terminal domain 3.69e-08
Further Details:      
 

Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
guanyl nucleotide binding 2.074 12.29
GTPase activity 2.202 11.9
purine ribonucleoside triphosphate binding 1.453 7.29
purine ribonucleoside binding 1.42 7.03
Cellular Component IC (bits) H-Score
microtubule 1.951 90.46
outer membrane 2.24 8.8
spindle pole 2.219 7.93
plastid 1.598 7.49
chloroplast part 1.897 7.49
plastid stroma 2.025 7.37
microtubule cytoskeleton 1.336 6.31
cell body 1.489 5.77
cell-cell junction 1.374 5.36
symplast 2.046 4.56
Biological Process IC (bits) H-Score
microtubule-based process 1.428 41.7
microtubule-based transport 1.93 15.76
developmental growth involved in morphogenesis 1.567 12.6
cell growth 1.736 12.6
epidermis development 1.476 12.6
developmental cell growth 1.901 12.6
cellular macromolecular complex assembly 1.469 12.14
protein polymerization 2.135 12.14
glucose metabolic process 1.877 10.85
mitotic cell cycle 1.525 10.61

Protein sequence

External link(s) Locus: YML124C   Protein: S000004593
Sequence length 445
Comment TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p"
Sequence
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
Download sequence
Identical sequences A6ZLU1 B3LLD6 C8ZE78 N1NZC7 P09734 W7PLM4 W7QWP3
YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C 4932.YML124C YML124C SCRT_01776 YML124C tr|A6ZLU1|A6ZLU1_YEAS7 YML124C YML124C YML124C YML124C YML124C YML124C YML124C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]