SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML124C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML124C
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 5.1e-94
Family Tubulin, GTPase domain 0.00000000599
Further Details:      
 
Domain Number 2 Region: 247-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.55e-81
Family Tubulin, C-terminal domain 0.0000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
GTPase activity 2.117 12.59
guanyl nucleotide binding 2.018 11.76
Biological Process IC (bits) H-Score
microtubule-based process 1.516 39.78
unidimensional cell growth 2.175 37.89
cell growth 1.644 28.84
seed development 2.096 28.28
nuclear division 1.795 26.75
meiotic cell cycle process 1.966 26.75
developmental growth involved in morphogenesis 1.605 23.09
response to lipid 1.512 20.76
response to organic cyclic compound 1.466 20.76
protein polymerization 2.142 20.4
Cellular Component IC (bits) H-Score
microtubule 1.886 69.34
polymeric cytoskeletal fiber 1.657 51.23
spindle 1.756 8.47
outer membrane 2.089 7.07
thylakoid 2.204 6.39
plastid 1.557 6.2
chloroplast part 1.842 6.2
plastid stroma 1.982 6.1
microtubule cytoskeleton 1.346 5.31
extracellular organelle 1.618 4.66

Protein sequence

External link(s) Locus: YML124C   Protein: S000004593
Sequence length 445
Comment TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p"
Sequence
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
Download sequence
Identical sequences A6ZLU1 B3LLD6 C8ZE78 N1NZC7 P09734 W7PLM4 W7QWP3
YML124C YML124C YML124C YML124C YML124C YML124C YML124C tr|A6ZLU1|A6ZLU1_YEAS7 YML124C SCRT_01776 4932.YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]