SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YML124C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML124C
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 5.1e-94
Family Tubulin, GTPase domain 5.99e-09
Further Details:      
 
Domain Number 2 Region: 247-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.55e-81
Family Tubulin, C-terminal domain 3.69e-08
Further Details:      
 

Protein sequence

External link(s) Locus: YML124C   Protein: S000004593
Sequence length 445
Comment TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p"
Sequence
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
Download sequence
Identical sequences A6ZLU1 B3LLD6 C8ZE78 N1NZC7 P09734 W7PLM4 W7QWP3
YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C 4932.YML124C YML124C SCRT_01776 YML124C tr|A6ZLU1|A6ZLU1_YEAS7 YML124C YML124C YML124C YML124C YML124C YML124C YML124C

Jump to [ Top of page · Domain architecture · Domain assignment details ]