SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YML124C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML124C
Domain Number 1 Region: 1-245
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 5.1e-94
Family Tubulin, GTPase domain 0.00000000599
Further Details:      
 
Domain Number 2 Region: 247-440
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 8.55e-81
Family Tubulin, C-terminal domain 0.0000000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
GTPase activity 2.078 11.98
purine ribonucleoside binding 1.983 11.75
guanyl ribonucleotide binding 1.991 11.17
Biological Process IC (bits) H-Score
plant epidermis development 2.228 37.65
microtubule-based process 1.533 36.29
unidimensional cell growth 2.174 35.93
cell growth 1.639 27.24
female gamete generation 1.494 25.88
meiotic cell cycle process 2.001 25.88
nuclear division 1.882 25.88
fruit development 2.075 25.66
microtubule-based movement 2.007 25.65
developmental growth involved in morphogenesis 1.583 21.78
Cellular Component IC (bits) H-Score
polymeric cytoskeletal fiber 1.651 47.95
cytoplasmic microtubule 2.128 27.04
microtubule cytoskeleton 1.399 6.44
outer membrane 2.082 6.27
plastid 1.489 5.54
thylakoid 2.149 5.54
chloroplast stroma 1.979 5.54
spindle microtubule 2.192 4.95
mitochondrial envelope 1.596 3.96

Protein sequence

External link(s) Locus: YML124C   Protein: S000004593
Sequence length 445
Comment TUB3 SGDID:S000004593, Chr XIII from 23684-23660,23361-22049, reverse complement, Verified ORF, "Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p"
Sequence
MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYG
KFVPRAIYVDLEPNVIDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVE
ERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLST
SVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVT
ASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPG
NQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEP
PSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFT
EAREDLAALERDYIEVGADSYAEEF
Download sequence
Identical sequences A6ZLU1 B3LLD6 C8ZE78 N1NZC7 P09734 W7PLM4 W7QWP3
YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C YML124C 4932.YML124C YML124C SCRT_01776 YML124C YML124C YML124C YML124C YML124C YML124C tr|A6ZLU1|A6ZLU1_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]