SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR044W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR044W
Domain Number 1 Region: 6-43,107-163
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-23
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleoplasm part 1.369 56.34
cytoplasmic ribonucleoprotein granule 1.929 34.11
intracellular ribonucleoprotein complex 1.368 20.06
cullin-RING ubiquitin ligase complex 2.116 14.38
organelle envelope 1.405 11.68
nuclear envelope 1.891 11.68
chromosomal part 1.512 9.56
cell body 1.534 9.32
methyltransferase complex 2.143 7.07
dendrite 1.582 5.94

Protein sequence

External link(s) Locus: YMR044W   Protein: S000004647
Sequence length 475
Comment IOC4 SGDID:S000004647, Chr XIII from 355383-356810, Verified ORF, "Member of a complex (Isw1b) with Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase activity and acts within coding regions to coordinate transcription elongation with termination and processing, contains a PWWP motif"
Sequence
MSEAIFQPTDIVLAKVKGFSAWPAMIIPNELIPDNILKTKPVSVHKGKSGSDKKANEDID
ADMESEARDREQSEEEEDIEDFGESEANPEKFIIYTPVLKFRKNDTLKSTYCVKFFCDDS
YIWVKPMDMKILTSEDCRKWLSGKQRKNKKLIPAYEMAMRGKNGIDIWEFVEYGSYGKPD
EEEYVEEEEEENEPEKKAIRPTRSSSRQRQKRASETEKSEGGNSNKRKRVTRSTRQQAID
ASEEEEEEEEEKVQEAVRKRPQRTKTKKVVVSKTKPNPKTKAKKEKPKPPKPIKYHFEDD
EDWSIVGLGPQDLSIEKTMDPIAKKLSQKKNLEKHVEIKLDLEDKLAGINKLLCDVLCSA
INQAVSIKDDFEIILDELQIALDTRGSRNEFITIFQSNNSLLLNFRILFNLRKRELNKWD
LWDRFQDIFKHIYSYQFIPDTEDWQLEQNMEIEEMDREKPSFSEDVKEEESKVGA
Download sequence
Identical sequences C7GL75 Q04213
YMR044W YMR044W YMR044W 4932.YMR044W YMR044W YMR044W YMR044W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]