SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR044W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR044W
Domain Number 1 Region: 6-43,107-163
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-23
Family PWWP domain 0.013
Further Details:      
 

Protein sequence

External link(s) Locus: YMR044W   Protein: S000004647
Sequence length 475
Comment IOC4 SGDID:S000004647, Chr XIII from 355383-356810, Verified ORF, "Member of a complex (Isw1b) with Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase activity and acts within coding regions to coordinate transcription elongation with termination and processing, contains a PWWP motif"
Sequence
MSEAIFQPTDIVLAKVKGFSAWPAMIIPNELIPDNILKTKPVSVHKGKSGSDKKANEDID
ADMESEARDREQSEEEEDIEDFGESEANPEKFIIYTPVLKFRKNDTLKSTYCVKFFCDDS
YIWVKPMDMKILTSEDCRKWLSGKQRKNKKLIPAYEMAMRGKNGIDIWEFVEYGSYGKPD
EEEYVEEEEEENEPEKKAIRPTRSSSRQRQKRASETEKSEGGNSNKRKRVTRSTRQQAID
ASEEEEEEEEEKVQEAVRKRPQRTKTKKVVVSKTKPNPKTKAKKEKPKPPKPIKYHFEDD
EDWSIVGLGPQDLSIEKTMDPIAKKLSQKKNLEKHVEIKLDLEDKLAGINKLLCDVLCSA
INQAVSIKDDFEIILDELQIALDTRGSRNEFITIFQSNNSLLLNFRILFNLRKRELNKWD
LWDRFQDIFKHIYSYQFIPDTEDWQLEQNMEIEEMDREKPSFSEDVKEEESKVGA
Download sequence
Identical sequences C7GL75 Q04213
YMR044W 4932.YMR044W YMR044W YMR044W YMR044W YMR044W YMR044W

Jump to [ Top of page · Domain architecture · Domain assignment details ]