SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR044W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR044W
Domain Number 1 Region: 6-43,107-163
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-23
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ribonucleoprotein granule 1.999 36.38
ribonucleoprotein complex 1.418 18.11
nuclear body 1.902 17.98
nucleoplasm part 1.418 17.98
ubiquitin ligase complex 1.933 13.66
chromosomal part 1.477 9.71
nuclear chromosome 1.72 8.56
chromatin 1.902 8.56
methyltransferase complex 2.218 7.74
nuclear membrane 2.218 5.94

Protein sequence

External link(s) Locus: YMR044W   Protein: S000004647
Sequence length 475
Comment IOC4 SGDID:S000004647, Chr XIII from 355383-356810, Verified ORF, "Member of a complex (Isw1b) with Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase activity and acts within coding regions to coordinate transcription elongation with termination and processing, contains a PWWP motif"
Sequence
MSEAIFQPTDIVLAKVKGFSAWPAMIIPNELIPDNILKTKPVSVHKGKSGSDKKANEDID
ADMESEARDREQSEEEEDIEDFGESEANPEKFIIYTPVLKFRKNDTLKSTYCVKFFCDDS
YIWVKPMDMKILTSEDCRKWLSGKQRKNKKLIPAYEMAMRGKNGIDIWEFVEYGSYGKPD
EEEYVEEEEEENEPEKKAIRPTRSSSRQRQKRASETEKSEGGNSNKRKRVTRSTRQQAID
ASEEEEEEEEEKVQEAVRKRPQRTKTKKVVVSKTKPNPKTKAKKEKPKPPKPIKYHFEDD
EDWSIVGLGPQDLSIEKTMDPIAKKLSQKKNLEKHVEIKLDLEDKLAGINKLLCDVLCSA
INQAVSIKDDFEIILDELQIALDTRGSRNEFITIFQSNNSLLLNFRILFNLRKRELNKWD
LWDRFQDIFKHIYSYQFIPDTEDWQLEQNMEIEEMDREKPSFSEDVKEEESKVGA
Download sequence
Identical sequences C7GL75 Q04213
YMR044W 4932.YMR044W YMR044W YMR044W YMR044W YMR044W YMR044W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]