SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR046C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR046C   Protein: S000004649
Sequence length 440
Comment YMR046C SGDID:S000004649, Chr XIII from 362626-361304, reverse complement, transposable_element_gene, "Retrotransposon TYA Gag gene co-transcribed with TYB Pol; translated as TYA or TYA-TYB polyprotein; Gag is a nucleocapsid protein that is the structural constituent of virus-like particles (VLPs); similar to retroviral Gag"
Sequence
MESQQLSQHSPISHGSACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPLS
SAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQANISGWPVYGHPSLMPYPPYQMSPM
YAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPND
FLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPPWVKDI
LSVDYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNN
GIPINNKVACQFIMRGLSGEYKFLRYARHRCIHMTVADLFSDIHSMYEEQQESKRNKSTH
RRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGS
TTEPIQLKNTHDLHLRPGTY
Download sequence
Identical sequences Q04215
YMR046C 4932.YMR046C YMR046C YMR046C

Jump to [ Top of page · Domain architecture · Domain assignment details ]