SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR060C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Most Informative Gene Ontologies

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR060C   Protein: S000004664
Sequence length 327
Comment SAM37 SGDID:S000004664, Chr XIII from 392514-391531, reverse complement, Verified ORF, "Component of the mitochondrial outer membrane sorting and assembly machinery (SAM) complex; required for the sorting of some proteins to the outer membrane after import by the TOM complex"
Sequence
MVKGSVHLWGKDGKASLISVDSIALVWFIKLCTSEEAKSMVAGLQIVFSNNTDLSSDGKL
PVLILDNGTKVSGYVNIVQFLHKNICTSKYEKGTDYEEDLAIVRKKDRLLEYSLLNYVDV
EISRLTDYQLFLNTKNYNEYTKKLFSKLLYFPMWYNTPLQLRSQARENCEEIIGSLTLED
DEEFVESKAMESASQLAQSKTFKIAHKNKIKGKQELQQVKYNLQFDNRLQSCVSNWLAAR
KKLDDSVILSSDLLFLANLYVQLGLPDGNRIRSKLEQTFGSELLNSMSNKIDDFVHRPSN
NLEQRDPQFREQGNVVMSLYNLACKYI
Download sequence
Identical sequences P50110
YMR060C YMR060C 4932.YMR060C YMR060C YT303 YMR060C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]