SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR070W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR070W
Domain Number 1 Region: 346-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-09
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Protein sequence

External link(s) Locus: YMR070W   Protein: S000004674
Sequence length 490
Comment MOT3 SGDID:S000004674, Chr XIII from 409153-410625, Verified ORF, "Nuclear transcription factor with two Cys2-His2 zinc fingers; involved in repression of a subset of hypoxic genes by Rox1p, repression of several DAN/TIR genes during aerobic growth, and repression of ergosterol biosynthetic genes"
Sequence
MNADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSLASQPFNT
TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNN
SNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYS
FPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNAANNGSNNSSHSAPAPAPGPPH
HHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNPSPNLNLNINPAQPLHLP
PGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSW
LKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNNSSSS
NNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRV
LNNLIVSHNK
Download sequence
Identical sequences P54785
YMR070W YMR070W 4932.YMR070W YMR070W YMR070W

Jump to [ Top of page · Domain architecture · Domain assignment details ]