SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR070W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR070W
Domain Number 1 Region: 346-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000316
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
nucleolus 1.641 7.25
nucleoplasm part 1.496 6.67
nuclear body 1.907 6.67
chromatin 1.822 5.88
ribonucleoprotein complex 1.414 5.53
small nuclear ribonucleoprotein complex 2.005 5.53
chromosomal region 1.98 5.46
SWI/SNF superfamily-type complex 2.178 5.41
chromosomal part 1.477 5.27

Protein sequence

External link(s) Locus: YMR070W   Protein: S000004674
Sequence length 490
Comment MOT3 SGDID:S000004674, Chr XIII from 409153-410625, Verified ORF, "Nuclear transcription factor with two Cys2-His2 zinc fingers; involved in repression of a subset of hypoxic genes by Rox1p, repression of several DAN/TIR genes during aerobic growth, and repression of ergosterol biosynthetic genes"
Sequence
MNADHHLQQQQQQRQQHQQQQHQQQQHQHQHQQQQHTILQNVSNTNNIGSDSLASQPFNT
TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNN
SNNSNNSNISASDYTVANNSTSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYS
FPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNAANNGSNNSSHSAPAPAPGPPH
HHHHHSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNPSPNLNLNINPAQPLHLP
PGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHKYIHQCQFCEKSFKRKSW
LKRHLLSHSQQRHFLCPWCLSRQKRKDNLLQHMKLKHTNYLLDELKKNNIIFNYNNSSSS
NNNNDNNNNNNSNSASGSGGAGAAAAAATAPENEDGNGYDTNIKTLINDGVLNKDDVKRV
LNNLIVSHNK
Download sequence
Identical sequences P54785
YMR070W YMR070W YMR070W 4932.YMR070W YMR070W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]