SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR093W
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.01e-44
Family WD40-repeat 0.0014
Further Details:      
 

Protein sequence

External link(s) Locus: YMR093W   Protein: S000004699
Sequence length 513
Comment UTP15 SGDID:S000004699, Chr XIII from 454014-455555, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSS
TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSI
NASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAA
PHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLT
SNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSG
PVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRM
MRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQE
LRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVL
QELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS
Download sequence
Identical sequences A6ZMF0 B3LLY4 E7KGN2 E7NLJ1 Q04305
YMR093W YMR093W YMR093W YMR093W YMR093W YMR093W YR300 YMR093W YMR093W 4932.YMR093W YMR093W SCRT_01983 YMR093W tr|A6ZMF0|A6ZMF0_YEAS7 YMR093W YMR093W YMR093W

Jump to [ Top of page · Domain architecture · Domain assignment details ]