SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR093W
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.01e-44
Family WD40-repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
endosome 1.351 9.77
cytoplasmic vesicle part 1.417 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YMR093W   Protein: S000004699
Sequence length 513
Comment UTP15 SGDID:S000004699, Chr XIII from 454014-455555, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSS
TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSI
NASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAA
PHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLT
SNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSG
PVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRM
MRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQE
LRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVL
QELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS
Download sequence
Identical sequences A0A0L8VJR9 A6ZMF0 B3LLY4 E7KGN2 E7NLJ1 N1NYC0 Q04305
YMR093W YMR093W YMR093W YMR093W YMR093W tr|A6ZMF0|A6ZMF0_YEAS7 4932.YMR093W YMR093W YMR093W YR300 YMR093W YMR093W YMR093W SCRT_01983 YMR093W YMR093W YMR093W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]