SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR093W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR093W
Domain Number 1 Region: 27-332
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.01e-44
Family WD40-repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YMR093W   Protein: S000004699
Sequence length 513
Comment UTP15 SGDID:S000004699, Chr XIII from 454014-455555, Verified ORF, "Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA"
Sequence
MSTARPRIITSKAPLLPQQTTPEQRYWRQYTSAQLVKEHNSVTHISFNPQHPHDFAVTSS
TRVQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGLVSVYDSYNPRTILLSI
NASTHPTHVTKFHTQDNKILATASDDRVTRLWDISNAYEPQLELTGATDYVRTLSFIPAA
PHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVENVIAVSPTQIVSCGGNNFKVWDLT
SNKKLYERGNFNKAVTCLDYVENFDSPMQSALIASSLDGHVKVFDPLDNFQVKFGWKFSG
PVLSCAVSPSTAQGNRHLVAGLSSGLLAIRTKKKEKRSSDKENAPASFNKNAKSNNFQRM
MRGSEYQGDQEHIIHNDKVRSQRRMRAFERNINQFKWSEALDNAFVPGMAKELTLTVLQE
LRKRGKVRVALYGRDESTLEPLLNWCLKGIEDVRSASIVADWVAVVLELYGNTLESSPVL
QELMIDLKTKVRHEIHKSKEAQRIEGMLQLLTS
Download sequence
Identical sequences A6ZMF0 B3LLY4 E7KGN2 E7NLJ1 N1NYC0 Q04305 W7PNF6 W7QX99
YMR093W YMR093W YMR093W YMR093W YMR093W YMR093W YR300 YMR093W YMR093W 4932.YMR093W YMR093W SCRT_01983 YMR093W tr|A6ZMF0|A6ZMF0_YEAS7 YMR093W YMR093W YMR093W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]