SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR116C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR116C
Domain Number 1 Region: 10-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-69
Family WD40-repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
regulation of organ morphogenesis 1.683 29.68
kidney development 1.515 26.51
digestive tract development 2.033 24.08
rRNA metabolic process 2.071 23.36
cilium assembly 1.378 22.22
RNA processing 1.499 17.76
telomere organization 2.237 16.58
microtubule-based movement 1.993 16.43
process utilizing autophagic mechanism 2.127 15.81
microtubule-based process 1.532 14.67
Cellular Component IC (bits) H-Score
cullin-RING ubiquitin ligase complex 2.116 52.17
transferase complex 1.369 36.23
organelle envelope 1.405 25.6
methyltransferase complex 2.143 21.65
cilium 1.675 18.56
nuclear transcription factor complex 2.016 13.21
membrane coat 2.044 11.36
cytoplasmic vesicle part 1.417 9.77
endosome 1.351 9.77
endosome membrane 1.934 9.77

Protein sequence

External link(s) Locus: YMR116C   Protein: S000004722
Sequence length 319
Comment ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "G-protein beta subunit and guanine nucleotide dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; represses Gcn4p in the absence of amino acid starvation"
Sequence
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS
FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS
MIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA
WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEV
FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT
LFAGYTDNVIRVWQVMTAN
Download sequence
Identical sequences A0A0L8RDD4 A0A0L8VJN0 A6ZMH3 B3LM07 C8ZEW9 G2WKG6 N1NYE0 P38011
YMR116C 000141466|e3izba1|5.1.4.201|a:1-319 000357717|e3frxB1|5.1.4.201|B:1-319 000408001|e3o2zT1|5.1.4.201|T:1-319 000408019|e3o30T1|5.1.4.201|T:1-319 001436083|e4v6iAa1|5.1.4.201|Aa:1-319 001439206|e4v7rAT1|5.1.4.201|AT:1-319 001439207|e4v7rCT1|5.1.4.201|CT:1-319 d3frxb_ YMR116C YMR116C YMR116C tr|A6ZMH3|A6ZMH3_YEAS7 YMR116C YMR116c___KOG0279 YMR116C YMR116C YMR116C YMR116C SCRT_02006 YMR116C 3frx.A 3frx.B 3frx.C 3frx.D 3j6x.RA 3j6y.RA 3j77.RC 3j78.RC 4v6i.Aa 4v7r.AT 4v7r.CT 4v88.Ag 4v88.Cg 4v8y.A6 4v8z.A6 5juo.WA 5jup.WA 5jus.WA 5jut.WA 5juu.WA 5mc6.O 4932.YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]