SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR116C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR116C
Domain Number 1 Region: 10-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-69
Family WD40-repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
ubiquitin ligase complex 1.933 42.44
nucleolus 1.651 36.87
methyltransferase complex 2.218 18.64
cilium 1.61 16.6
nucleoplasm part 1.419 11.44
transcription factor complex 1.881 11.44
cytoplasmic vesicle part 1.737 10.36
cytoplasmic vesicle membrane 1.917 10.36
SWI/SNF superfamily-type complex 2.177 9.97
DNA-directed RNA polymerase complex 2.004 7.97

Protein sequence

External link(s) Locus: YMR116C   Protein: S000004722
Sequence length 319
Comment ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "G-protein beta subunit and guanine nucleotide dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; represses Gcn4p in the absence of amino acid starvation"
Sequence
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS
FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS
MIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA
WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEV
FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT
LFAGYTDNVIRVWQVMTAN
Download sequence
Identical sequences A6ZMH3 B3LM07 C8ZEW9 G2WKG6 N1NYE0 P38011 W7PY44 W7R747
YMR116C YMR116c___KOG0279 YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C tr|A6ZMH3|A6ZMH3_YEAS7 YMR116C YMR116C YMR116C YMR116C SCRT_02006 YMR116C YMR116C YMR116C YMR116C 4932.YMR116C 1vw9.h 1vwv.h 1vxv.s 1vxy.s 3frx.A 3frx.B 3frx.C 3frx.D 3izb.a 3o2z.T 3o30.T 3u5c.g 3u5g.g 4byl.6 4byt.6 YMR116C YMR116C YMR116C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]