SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR116C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR116C
Domain Number 1 Region: 10-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-69
Family WD40-repeat 0.00013
Further Details:      
 

Protein sequence

External link(s) Locus: YMR116C   Protein: S000004722
Sequence length 319
Comment ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "G-protein beta subunit and guanine nucleotide dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; represses Gcn4p in the absence of amino acid starvation"
Sequence
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS
FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS
MIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA
WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEV
FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT
LFAGYTDNVIRVWQVMTAN
Download sequence
Identical sequences A6ZMH3 B3LM07 C8ZEW9 G2WKG6 P38011
YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C 4932.YMR116C YMR116C SCRT_02006 YMR116C YMR116C YMR116C tr|A6ZMH3|A6ZMH3_YEAS7 YMR116C 3frx.A 3frx.B 3frx.C 3frx.D 3izb.a 3o2z.T 3o30.T 3u5c.g 3u5g.g YMR116C YMR116C YMR116C YMR116c___KOG0279 YMR116C YMR116C

Jump to [ Top of page · Domain architecture · Domain assignment details ]