SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR116C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR116C
Domain Number 1 Region: 10-316
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-69
Family WD40-repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR116C   Protein: S000004722
Sequence length 319
Comment ASC1 SGDID:S000004722, Chr XIII from 500687-500151,499877-499455, reverse complement, Verified ORF, "G-protein beta subunit and guanine nucleotide dissociation inhibitor for Gpa2p; ortholog of RACK1 that inhibits translation; core component of the small (40S) ribosomal subunit; represses Gcn4p in the absence of amino acid starvation"
Sequence
MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRS
FKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKAS
MIISGSRDKTIKVWTIKGQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKA
WNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLSAQDEV
FSLAFSPNRYWLAAATATGIKVFSLDPQYLVDDLRPEFAGYSKAAEPHAVSLAWSADGQT
LFAGYTDNVIRVWQVMTAN
Download sequence
Identical sequences A0A0L8RDD4 A0A0L8VJN0 A0A250WEF4 A6ZMH3 B3LM07 C8ZEW9 G2WKG6 N1NYE0 P38011
YMR116C YMR116C YMR116C YMR116C YMR116C 000141466|e3izba1|5.1.4.201|a:1-319 000357717|e3frxB1|5.1.4.201|B:1-319 000408001|e3o2zT1|5.1.4.201|T:1-319 000408019|e3o30T1|5.1.4.201|T:1-319 001436083|e4v6iAa1|5.1.4.201|Aa:1-319 001439206|e4v7rAT1|5.1.4.201|AT:1-319 001439207|e4v7rCT1|5.1.4.201|CT:1-319 d3frxb_ YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C YMR116C 3frx.A 3frx.B 3frx.C 3frx.D 3j6x.RA 3j6y.RA 3j77.RC 3j78.RC 4v6i.Aa 4v7r.AT 4v7r.CT 4v88.Ag 4v88.Cg 4v8y.A6 4v8z.A6 5juo.WA 5jup.WA 5jus.WA 5jut.WA 5juu.WA 5mc6.O SCRT_02006 YMR116C YMR116C YMR116C YMR116C NP_013834.1.97178 XP_018220171.1.77003 YMR116c___KOG0279 4932.YMR116C tr|A6ZMH3|A6ZMH3_YEAS7 YMR116C YMR116C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]