SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR133W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR133W   Protein: S000004740
Sequence length 428
Comment REC114 SGDID:S000004740, Chr XIII from 536206-537447,537564-537608, Verified ORF, "Protein involved in early stages of meiotic recombination; possibly involved in the coordination of recombination and meiotic division; mutations lead to premature initiation of the first meiotic division"
Sequence
MYEYCSVVIKKYSKYTIPSFAPNGFQSMLEPPQIDKWQHLSANCTLQFRVLLMDSRQILI
NVVLNNSTLLENIRLPLGDNQDLIQFSCKSPIISCKYISEEFGPRMLRRFQMNLPNDVEF
NRTVVSLKNLNFVLRTARTSIAQSTITSQVQGNNNGTKVCFTEGPKVSSYTNPNTQFQTQ
NMIMDFSQRYQEESERESNNRSNITLPHDSIQIAQQIWPNTDLNVVQSSQDLNTPMATQT
VLGRPESLIVQPLEVSQSPPNTTNCLPNAENKKKKVDTTSDFTSRKEIALCKTGLLETIH
IPKERESQMQSVTGLDATPTIIWSPGKDNTAKKNTSNKKNIDDKLTNPQKSGNTHTPDRN
KEVLPNGTLNETRKEASPSEGLTIRVKNVNRNASRKISKRLIKEKLKDEEFMKWVNKVET
VLNKMFEK
Download sequence
Identical sequences A6ZMJ3 C8ZEY8 P32841 W7PM89 W7QUM3
4932.YMR133W YMR133W YMR133W tr|A6ZMJ3|A6ZMJ3_YEAS7 YMR133W YMR133W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]