SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR133W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR133W   Protein: S000004740
Sequence length 428
Comment REC114 SGDID:S000004740, Chr XIII from 536206-537447,537564-537608, Verified ORF, "Protein involved in early stages of meiotic recombination; possibly involved in the coordination of recombination and meiotic division; mutations lead to premature initiation of the first meiotic division"
Sequence
MYEYCSVVIKKYSKYTIPSFAPNGFQSMLEPPQIDKWQHLSANCTLQFRVLLMDSRQILI
NVVLNNSTLLENIRLPLGDNQDLIQFSCKSPIISCKYISEEFGPRMLRRFQMNLPNDVEF
NRTVVSLKNLNFVLRTARTSIAQSTITSQVQGNNNGTKVCFTEGPKVSSYTNPNTQFQTQ
NMIMDFSQRYQEESERESNNRSNITLPHDSIQIAQQIWPNTDLNVVQSSQDLNTPMATQT
VLGRPESLIVQPLEVSQSPPNTTNCLPNAENKKKKVDTTSDFTSRKEIALCKTGLLETIH
IPKERESQMQSVTGLDATPTIIWSPGKDNTAKKNTSNKKNIDDKLTNPQKSGNTHTPDRN
KEVLPNGTLNETRKEASPSEGLTIRVKNVNRNASRKISKRLIKEKLKDEEFMKWVNKVET
VLNKMFEK
Download sequence
Identical sequences A6ZMJ3 C8ZEY8 P32841 W7PM89 W7QUM3
YMR133W 4932.YMR133W YMR133W YMR133W YMR133W tr|A6ZMJ3|A6ZMJ3_YEAS7

Jump to [ Top of page · Domain architecture · Domain assignment details ]