SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR138W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR138W
Domain Number 1 Region: 13-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-38
Family G proteins 0.00018
Further Details:      
 

Protein sequence

External link(s) Locus: YMR138W   Protein: S000004746
Sequence length 191
Comment CIN4 SGDID:S000004746, Chr XIII from 545154-545729, Verified ORF, "GTP-binding protein involved in beta-tubulin (Tub2p) folding; isolated as mutant with increased chromosome loss and sensitivity to benomyl; regulated by the GTPase-activating protein, Cin2p, the human retinitis pigmentosa 2 (RP2) homolog"
Sequence
MGLLSIIRKQKLRDKEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMI
KDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRI
GYECAVIVVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLR
DRLVESCHFTQ
Download sequence
Identical sequences B3LM26 B5VPR6 C7GU80 C8ZEZ4 E7KGS2 E7KSQ2 E7QJC4 P39110 W7PY75 W7R9L0
YMR138W YMR138W 4932.YMR138W YMR138W YMR138W SCRT_02029 YMR138W YMR138W YMR138W YMR138W YMR138w___KOG0073 YMR138W YMR138W YMR138W YMR138W

Jump to [ Top of page · Domain architecture · Domain assignment details ]