SUPERFAMILY 1.75 HMM library and genome assignments server

Please note: Superfamily is currently under maintenance and some functionality may be limited. Please bear with us as we fix these problems.

Domain assignment for YMR138W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR138W
Domain Number 1 Region: 13-185
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.79e-38
Family G proteins 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
microtubule associated complex 1.998 25.22
chromosomal part 1.478 20.33
nucleoplasm part 1.419 15.58
endosome 1.322 14.28
cilium 1.61 13.75
extrinsic to plasma membrane 1.991 12.72
internal side of plasma membrane 2.098 12.69
extracellular organelle 1.592 12.36
transcription factor complex 1.881 9.42
DNA-directed RNA polymerase complex 2.004 9.42

Protein sequence

External link(s) Locus: YMR138W   Protein: S000004746
Sequence length 191
Comment CIN4 SGDID:S000004746, Chr XIII from 545154-545729, Verified ORF, "GTP-binding protein involved in beta-tubulin (Tub2p) folding; isolated as mutant with increased chromosome loss and sensitivity to benomyl; regulated by the GTPase-activating protein, Cin2p, the human retinitis pigmentosa 2 (RP2) homolog"
Sequence
MGLLSIIRKQKLRDKEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMI
KDVTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRI
GYECAVIVVLNKIDLVEDKSELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGIDNLR
DRLVESCHFTQ
Download sequence
Identical sequences B3LM26 B5VPR6 C7GU80 C8ZEZ4 E7KGS2 E7KSQ2 E7QJC4 P39110 W7PY75 W7R9L0
YMR138W YMR138W YMR138W YMR138W YMR138W YMR138W YMR138W YMR138W YMR138W YMR138W YMR138w___KOG0073 YMR138W YMR138W SCRT_02029 4932.YMR138W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]