SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR142C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR142C   Protein: S000004750
Sequence length 199
Comment RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein"
Sequence
MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLDLLRPVVRA
PTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPRDGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFR
GIREKRAREKAEAEAEKKK
Download sequence
Identical sequences A6ZMK1 C8ZEZ8 G2WKJ3 P40212
YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C 4932.YMR142C YMR142C YMR142C tr|A6ZMK1|A6ZMK1_YEAS7 YMR142C YMR142C YMR142C YMR142C YMR142c___KOG3295 YMR142C

Jump to [ Top of page · Domain architecture · Domain assignment details ]