SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YMR142C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR142C   Protein: S000004750
Sequence length 199
Comment RPL13B SGDID:S000004750, Chr XIII from 551206-551203,550800-550205, reverse complement, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl13Ap; not essential for viability; has similarity to rat L13 ribosomal protein"
Sequence
MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARAARAAKIAPRPLDLLRPVVRA
PTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEIFDANVQRLKEYQ
SKIIVFPRDGKAPEAEQVLSAAATFPIAQPATDVEARAVQDNGESAFRTLRLARSEKKFR
GIREKRAREKAEAEAEKKK
Download sequence
Identical sequences A0A0L8VJK9 A6ZMK1 C8ZEZ8 G2WKJ3 P40212
YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142C YMR142c___KOG3295 YMR142C YMR142C YMR142C 4932.YMR142C YMR142C YMR142C tr|A6ZMK1|A6ZMK1_YEAS7 YMR142C YMR142C YMR142C YMR142C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]