SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR149W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Protein sequence

External link(s) Locus: YMR149W   Protein: S000004757
Sequence length 286
Comment SWP1 SGDID:S000004757, Chr XIII from 560995-561855, Verified ORF, "Delta subunit of the oligosaccharyl transferase glycoprotein complex, which is required for N-linked glycosylation of proteins in the endoplasmic reticulum"
Sequence
MQFFKTLAALVSCISFVLAYVAQDVHVSFPSTAGKSRVMIGKVEPRIGIDETVPTTITVE
DPNEVIQVNFAIESTNKPFQNTLLIGLPNKNLEMAFEPEIKDNGKLSMYKYRIDLAKLDA
ALLQEASRSPEPIKATLILASSTAKPKENLFREILQLNLNFDVDHSDSSLVDKFGIKPEI
HHIFHAEPKRVAKPIAVIFVLIIFITILSLIVTWLNSCAAAFNNIPTGVTAVYFLGFIAT
IVGFEVIFARYYLGTSIFETLFSSLYLGAPGLLTSTKFLRSFGQTI
Download sequence
Identical sequences G2WKK0 Q02795
YMR149W 4932.YMR149W YMR149W YMR149W YMR149W

Jump to [ Top of page · Domain architecture · Domain assignment details ]