SUPERFAMILY 1.75 HMM library and genome assignments server

Domain assignment for YMR159C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YMR159C
Domain Number - Region: 65-135
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0037
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YMR159C   Protein: S000004769
Sequence length 150
Comment ATG16 SGDID:S000004769, Chr XIII from 574927-574475, reverse complement, Verified ORF, "Protein that interacts with the Atg12p-Atg5p conjugate during formation of the pre-autophagosomal structure; essential for autophagy"
Sequence
MGNFIITERKKAKEERSNPQTDSMDDLLIRRLTDRNDKEAHLNELFQDNSGAIGGNIVSH
DDALLNTLAILQKELKSKEQEIRRLKEVIALKNKNTERLNDELISGTIENNVLQQKLSDL
KKEHSQLVARWLKKTEKETEAMNSEIDGTK
Download sequence
Identical sequences A6ZML8 B3LM47 C7GU63 E7KGT9 E7KSR8 E7LYT0 E7Q7W6 E7QJD8 G2WKL1 H0GL73 N1P0E8 Q03818 W7PEU0 W7QXE5
YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C 4932.YMR159C YMR159C SCRT_02050 YMR159C YMR159C YMR159C sp|A6ZML8|ATG16_YEAS7 YMR159C YMR159C YMR159C YMR159C YMR159C YMR159C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]